SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675744|ref|NP_936140.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37675744|ref|NP_936140.1|
Domain Number - Region: 184-350
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00952
Family Matrix metalloproteases, catalytic domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37675744|ref|NP_936140.1|
Sequence length 395
Comment hypothetical protein VVA0084 [Vibrio vulnificus YJ016]
Sequence
MHTRLLVLALPILVSSFTMANEVNYHIRISPTSEDQLRFSASTRHLGKFTVEPPRSLTSA
MPPALSCLQDERFTSIQYGTEVECDRIEWQTTAEKVPDQGFEPSNQNDSYSPQQGWYFVS
EYDSLPRIPQADITLVCTPDQRCYTLPDPTLPPLFLVWGMDTARIPISGQHVRVHVEDAK
VIDVQQRWLPTMQKQLSYLHRVFPQSNMAGWELAFFKRDKNAGSLGGAAGTNMLLVNSLL
DQGELTDESLQLLLKISAHESIHYMDKRKNSLWKSESLAEYYALKSLMNTEITFESPETL
WQQFAQKYPLATTGLYEAEHQVLEQGNRQYYPLFYFKGAAFWYALDQALQAHGASLDQWQ
QIELGREAELDAKIITQLQAIIGEERWQALAEKYL
Download sequence
Identical sequences Q7MG85
gi|37675744|ref|NP_936140.1| WP_011151514.1.34622 196600.VVA0084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]