SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675805|ref|NP_936201.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675805|ref|NP_936201.1|
Domain Number 1 Region: 496-854
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.58e-75
Family NagZ-like 0.0011
Further Details:      
 
Domain Number 2 Region: 25-94,125-288
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 1.09e-33
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37675805|ref|NP_936201.1|
Sequence length 933
Comment beta-glucosidase-related glycosidase [Vibrio vulnificus YJ016]
Sequence
MRNPAIEKAQQALVSVSRQAAAEGIVLLKNDDQALPIEPSQVLSLFGRCQMDTYRSGTGS
GGAVNVPYAVNALQGLQANPTIQLNTSLIALYQDWLAHHPFDDGGGGWAAEPWFQHEMPL
TDEVVAQAASQSDKALVFIGRTAGEDKDYADEAGSYRLTELETDMLTKVCRHFSCVIVVM
NVTNIIDMSWLTRLENHHAIKAVLYSWAAGMEGGHALADVLSGAVSPSGRLTDTIAHRLQ
DYPSSAHFGRKDFNLYAEDIYVGYRYFETFAPEAVQFEFGAGLSYSQFERRLVQCSSDVA
DAGGDLTTANALTFEIEVRNIGQQFSSKEVVQLYVEAPQGQLGKPARALCGFAKTSELAP
NGCEVVRISVPVALLASFDDSGASGYPNSYVLEAGQYHFYLGGSVRQAQKIDETWWVEHT
TSLETLSEACAPTREFERLVPAERHANGIYQPRYQPVPQRTVDLAQRIEANLPPTYAFTG
DQGIKLADVAQGRASLEAFVAQLTAEQLAILVRGEGMCSPKVTPGTAAAFGGVCTSLFEF
GIPVAAAADGPSGIRMDSGHQATQVPIGTLLACTWNTELNQQLYYLVGQELQAYQIDTLL
GPGINIHRHPLNGRNFEYFSEDPLLTGWIAAAQTTGLKQAGVSGTIKHFAANDQETARVD
VDSVMSQRALREIHIKPFEMAVKYGQASTIMTAYNPVNGHWAASNYDLNTTILRGEWGYT
GIVMTDWWAKMNHPVDGGEESKRFTGYMLRAQNDLYMVVENDAAERNPMDDDTLHALTHG
ELTLGELQRSAMNICRFILQAPVMQRPLQAYQAVKPFAPLADALPDAAPLLPVTQRMVVN
SQNHWELWVEVAQAGHYLCFAEMAYDREPLAQSSCSLSINGEFAMSLPTNGTEGKTVEIE
GIAIHLQAGIYRIDTQFVKKGAELKTLRFEWQA
Download sequence
Identical sequences Q7MG24
WP_011151570.1.34622 gi|37675805|ref|NP_936201.1| 196600.VVA0145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]