SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675816|ref|NP_936212.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675816|ref|NP_936212.1|
Domain Number 1 Region: 797-1022
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.49e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00042
Further Details:      
 
Domain Number 2 Region: 286-480
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.71e-34
Family Multidrug efflux transporter AcrB transmembrane domain 0.00024
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.32e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0031
Further Details:      
 
Domain Number 4 Region: 177-259
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.09e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0067
Further Details:      
 
Domain Number 5 Region: 725-797
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000115
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.015
Further Details:      
 
Domain Number 6 Region: 136-175,262-317
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000602
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.014
Further Details:      
 
Weak hits

Sequence:  gi|37675816|ref|NP_936212.1|
Domain Number - Region: 560-653
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0497
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37675816|ref|NP_936212.1|
Sequence length 1033
Comment hypothetical protein VVA0157 [Vibrio vulnificus YJ016]
Sequence
MIRFFAKHPTAANLLMLTLLILGISSLSTIKRETFPEFDPPYIMAAVVYPGASPQEVEES
ICVRMEDAVDGLANIVETQCEAIEGSARLILKLNEKADISRMLVDVQTQINAINDFPKEI
ESPVVQELDWNEPVVDVAITADTTWPELKAYAEQLKRTLKLDYGVSLVSVAGFSDHQYRV
ELDTQAMRQLGLSVGDIADQIGRQNVKLPSGNVETPDKHFLIRFDERRVTPQELSTIVVG
SGPNGSLIRLGDIATISDRFELDEQKVLFDGHPSALLKISKNKEDDALRIKDRVTQFVAD
QQAIAPDGVQLEMTNDLSSVLWDRLTMMVRNGWQGIVLVFATMWLFFSLRYSFWVAAGLP
VAFLGGLFLMAQLGLSINIMSLVGLLMAIGIMMDDAIVIAESIAAHLDRGEKIDDAVIKG
VNKVLPGVISSFLTTVCIFGSLLFLQGEMGAVLKAVPQVLILVLTLSLVEAFLILPNHLA
HSLHKQKQERPDLKFKQTLLEHFEHFRNTTLVNAVEKVVEFRYAFMGGVLALLLISAATL
AGGLLKFQPFPELDGDIAEARIILPPGASLAQTEAVVDKIVASAQKLDRQWSEEKENGTP
LVRHITSQFNANADANESGPHIATVRLDLLGAESRNTVIDEFIAAWRDDVGELAAPISLV
FKQPTMGPGGRAIEIRAKHDDLDALKAASIDIQQYLNQFAGVHGVLDDMRMGKEEVLVKL
RPGAEVYGINGQLIANQLRAAFFGQTADEIQLGVENISIEVRLDKVQAGDLQQLANFPIM
MADGSQIPLATIATLDFQRNYVRIQRIDGLRTISVFGDVDNTQANSTAIIRQFQQQEAPK
LMQKYPGLRFDFEGEAKDTAETGSSMGKGFLLGLFGVFAILSYQFRSYLEPFVVMLAIPL
AFIGVVWGHILLGHSLSMPSMMGFVSLAGIVVNDSILLVQYIRHHVDEGDSVHDSVVKAS
RERFRAVFLTSMTTAAGLLPLLTETSLQAQVIQPLVISIVFGILASTLLVLFMIPAAYAI
LADFGLVHKHQEI
Download sequence
Identical sequences Q7MG13
WP_011151581.1.34622 196600.VVA0157 gi|37675816|ref|NP_936212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]