SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675825|ref|NP_936221.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675825|ref|NP_936221.1|
Domain Number 1 Region: 330-618
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.91e-99
Family beta-glycanases 0.00000000105
Further Details:      
 
Domain Number 2 Region: 737-1028
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.24e-90
Family beta-Galactosidase, domain 5 0.000000369
Further Details:      
 
Domain Number 3 Region: 9-215
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-65
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000000433
Further Details:      
 
Domain Number 4 Region: 617-726
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 3.17e-26
Family beta-Galactosidase/glucuronidase domain 0.00085
Further Details:      
 
Domain Number 5 Region: 219-329
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.93e-22
Family beta-Galactosidase/glucuronidase domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37675825|ref|NP_936221.1|
Sequence length 1031
Comment beta-D-galactosidase [Vibrio vulnificus YJ016]
Sequence
MTAFSEILQRRDWENPQSVNIHCLKAHSPLASFRDMAHARDGIHAQRQSLNGQWKFKLFD
APEQVDGQFTQADFNDAEWDEIPVPSNWQLHGYDKPIYANIKYPFDVNPPFVPRENPTGC
YRTRVSLSPEDLLNTQRIIFDGVNSAFHLWCNGTWVGYSQDSRLPAEFDLTSHLVAGENT
LAVMVMRWCDGSYLEDQDMWWLSGIFRDVTLLSKPQHCIEDVFITPDLDACYRDGSLSIV
TTIAAPETYQVQVQLFEGTQAVTEPNIDRPHNRRIDERGTWNDVVFQTLHLREPKKWTAE
TPNLYRLVVSLLDENGTHLESEAYPVGFRKVEISEGQLKLNGKPLLIRGVNRHEHHPELG
HVMTEEDMIRDICLMKQYNFNAVRTAHYPNHPRWYELCDQYGLYVCDEANIETHGMQPMS
RLSSDPQWAHAYMSRYTQMVLRDKNHPSIIIWSLGNESGHGSNHNAMYAWSKNFDPSRPV
QYEGGGSNTTATDIIAPMYARVNTLIADEAVPKWPIKKWISLPNETRPLILCEYAHAMGN
SLGSFDEYWAAFREFPRLQGGFIWDWVDQGLSQWDENGQHFWAYGGDFGDEINDRQFCIN
GLIFPDRTVHPTLQEAKYCQRMITVSLQEQTQKACTLLVTNENLFRATDNEQLNWSLLEN
GQVIQTGSLALSVEADSQTRLEIALNFTPKAQAQYHLNTDICLIEATSWAPAGHVVATEQ
MALRNHAGLAIPTLRTQPAPKLTQDGHAIVVSSLDEKHQWRWDSQSGLLMEWNVDGKAQM
LAAPQDNFFRAPLDNDIGISEVDNVDPNAWVCRWEMAGIGQWERHCVHCDSETLAHTVVV
TTTFAYHFGGDVQAITQWTHTLSNDGEMLLDVDVTLADTLPPMPRIGLELQLPLYQADTP
ITWQGLGPFENYPDRLAAARFGLHTQTLAQMHTPYIFPTDSGLRCGTQWLQVNELAISGD
FQFSVSQYAQQQLAEAKHTHDLLAQERIYLRLDHQHMGVGGDDSWSPSVHKEFQLTEKHY
RYQLRFKPASR
Download sequence
Identical sequences Q7MG04
WP_011151589.1.34622 196600.VVA0165 gi|37675825|ref|NP_936221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]