SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675850|ref|NP_936246.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675850|ref|NP_936246.1|
Domain Number 1 Region: 129-250
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 2.09e-18
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0042
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily HPr-like 0.00000000000222
Family HPr-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37675850|ref|NP_936246.1|
Sequence length 259
Comment phosphotransferase system mannitol/fructose-specific IIA domain-containing protein [Vibrio vulnificus YJ016]
Sequence
MMHEYQVTFLVNDVNASAHVAQPLSRVARKFKSTLHIINITQNRSAELAKSLAVLQVGLQ
EGDFCQITAIGIDAELACFVIKDMLSDHFTVVGSKINYEFSSHLAERLPQICPPAEVKWH
YAKAHTELTKFECLKGLAQLIYPVSPDELILAFIKREERSSTCVAPGIAIPHVMFEGIEH
IAVAVIKNDESMDWASKMGDVHLAIALVMPSKPNREQIIAATNLTRNLLCDQMVERLLLT
RSGVDLQALLMYAMSRLLN
Download sequence
Identical sequences Q7MFX9
WP_011151613.1.21633 WP_011151613.1.22778 WP_011151613.1.34622 gi|37675850|ref|NP_936246.1| 196600.VVA0190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]