SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675903|ref|NP_936299.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675903|ref|NP_936299.1|
Domain Number 1 Region: 51-456
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.63e-70
Family Amylase, catalytic domain 0.0000433
Further Details:      
 
Domain Number 2 Region: 459-534
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000209
Family alpha-Amylases, C-terminal beta-sheet domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|37675903|ref|NP_936299.1|
Domain Number - Region: 573-619
Classification Level Classification E-value
Superfamily E set domains 0.07
Family AMPK-beta glycogen binding domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37675903|ref|NP_936299.1|
Sequence length 683
Comment glycosidase [Vibrio vulnificus YJ016]
Sequence
MSEKSNKEINVKQVLTTLSLAVTAALLAGCNASSKVDTPPTANAYRCDAVSMNKADDLRI
YQVMVESFVNGNDQIGHGTGYGTSHHKGDIQGIIDSLDYIQSLGMNGIWLTPIFNSEPKA
GQDHWADRLDATGYFATNYFEVDPRFGTMDDAKRLVEEAHARGLYVFFDGVFGHHKGNVA
ASPTGKLPAGSNNPVDYPESLAFYQEVAEFWIKELKIDGWRLDQAYQVPKEAWVEIRKTV
DNASKAVTYTNSKGETVNPLGYMVAEIWAGENRIIETGYGSNENPALCSAFDFPVRYRLV
ETFGVNEAGVGGKSGEWLAEGMNLHALYPEHAKPNLMIGNHDLVRFGDLLQRGNIAQPQD
EEYWLRHKAVFAFQAAYTGPITLYYGDEIGDQVENFAAKVEQDCAVKGLCDDHVARSSGK
VEGVTATLNANEQDLKHYIQQLMNLRNQHPALSQGKRVNVLADNKTYIDHKSTDSEAILY
VANISKHLQYLQLDAVKAGSEGHLTDLINGEEIKLIDGQYLIPLAPLEARFLSIEQPAKA
GPQIAKMALASGIGEGFMAQCDNPTVDEKGPMRKKLYVVGDFSDSSWQHKDHRQFEYKGD
GIYQVVTNEKPGSYRMQYAAKTWTPQFTAKGLSLKLGQENPLIKGGYGKDTAVTIMDEGR
YVWSLQFDEQGTPLNVMASKCAE
Download sequence
Identical sequences Q7MFS6
gi|37675903|ref|NP_936299.1| WP_011151662.1.17874 WP_011151662.1.34622 WP_011151662.1.67868 196600.VVA0243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]