SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675920|ref|NP_936316.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675920|ref|NP_936316.1|
Domain Number 1 Region: 10-213
Classification Level Classification E-value
Superfamily YrdC/RibB 7.78e-82
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37675920|ref|NP_936316.1|
Sequence length 218
Comment 3,4-dihydroxy-2-butanone 4-phosphate synthase [Vibrio vulnificus YJ016]
Sequence
MNQSSLLAEFGDPITRVENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMI
RECSGIVCLCLTDEHANKLELPPMVVNNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIK
TAANPSAKADDLARPGHVFPLRARPGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPD
GTMAKTPEIIAFGKQHNMPVLTIEDMVMYRNQYDLKLA
Download sequence
Identical sequences A0A2J9YH61 Q7MFR0 Q8D485
196600.VVA0260 216895.VV2_1426 gi|37675920|ref|NP_936316.1| gi|27367788|ref|NP_763315.1| gi|320158066|ref|YP_004190444.1| WP_011082301.1.17874 WP_011082301.1.25536 WP_011082301.1.34622 WP_011082301.1.73066 WP_011082301.1.8379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]