SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676019|ref|NP_936415.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676019|ref|NP_936415.1|
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.000000000000173
Family Outer membrane lipoprotein 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676019|ref|NP_936415.1|
Sequence length 92
Comment outer membrane lipoprotein [Vibrio vulnificus YJ016]
Sequence
MNKILIAAATSSVLLLAGCASGPDEQTKAAMAQVEDLKNQVDVLTKEVAALKSNQADAEM
KAKEAATAAMAAQEEAERANERIDNIAQSYTK
Download sequence
Identical sequences A0A087IRR1 A0A0H0XVR7 A0A1L9KY80 Q7MFG1
WP_011082394.1.100126 WP_011082394.1.13374 WP_011082394.1.16238 WP_011082394.1.17874 WP_011082394.1.21633 WP_011082394.1.22486 WP_011082394.1.22778 WP_011082394.1.24453 WP_011082394.1.25536 WP_011082394.1.28215 WP_011082394.1.28571 WP_011082394.1.30871 WP_011082394.1.31968 WP_011082394.1.33883 WP_011082394.1.34622 WP_011082394.1.39407 WP_011082394.1.39524 WP_011082394.1.43691 WP_011082394.1.47396 WP_011082394.1.49981 WP_011082394.1.512 WP_011082394.1.53345 WP_011082394.1.53782 WP_011082394.1.54486 WP_011082394.1.54603 WP_011082394.1.54858 WP_011082394.1.55006 WP_011082394.1.553 WP_011082394.1.58875 WP_011082394.1.58885 WP_011082394.1.59022 WP_011082394.1.59048 WP_011082394.1.59451 WP_011082394.1.60167 WP_011082394.1.60868 WP_011082394.1.61535 WP_011082394.1.63462 WP_011082394.1.63825 WP_011082394.1.65015 WP_011082394.1.66219 WP_011082394.1.66581 WP_011082394.1.67868 WP_011082394.1.73066 WP_011082394.1.73173 WP_011082394.1.78369 WP_011082394.1.78668 WP_011082394.1.79678 WP_011082394.1.81060 WP_011082394.1.81460 WP_011082394.1.81555 WP_011082394.1.82587 WP_011082394.1.8292 WP_011082394.1.8379 WP_011082394.1.84562 WP_011082394.1.86005 WP_011082394.1.86748 WP_011082394.1.89979 WP_011082394.1.90288 WP_011082394.1.93668 WP_011082394.1.94371 WP_011082394.1.95941 WP_011082394.1.96968 WP_011082394.1.9921 WP_011082394.1.99976 gi|320158162|ref|YP_004190540.1| 196600.VVA0359 216895.VV2_1545 gi|37676019|ref|NP_936415.1| gi|27367892|ref|NP_763419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]