SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676023|ref|NP_936419.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676023|ref|NP_936419.1|
Domain Number 1 Region: 174-490
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.32e-43
Family Thermolysin-like 0.015
Further Details:      
 
Domain Number 2 Region: 593-721
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.42e-18
Family Proprotein convertase P-domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676023|ref|NP_936419.1|
Sequence length 767
Comment hypothetical protein VVA0363 [Vibrio vulnificus YJ016]
Sequence
MESKMKSKLTLLALLLAMNPLANAAQWDYPEERVTLNSAEQVQQFVQQHYADQGEFKLRY
QTTSLLGHHYNFDVWQHGQYQQQKSLVVTTDQQHRVARVFRSLENTVLLNGEPTTAVELE
HPRRLEADFPPALEQGELETVEIQVFDPDLRTQQQLPAPSSGWNSMDDYPGAMEYQRRNV
SLLKNDQGYFLRNRNVVEVDAKALISVEAQDGVPVRDESGFAAPSGISHFAALADLQALQ
SNDPRFLAVMAFYHLDHSLEYTKTLGYALFNDPLKFDGRGLSANNSTYYKGPQAAMFGLG
GVSPDAMDADVILHELGHGIHYQIVPDWAYGHSGAIGEGFGDYWAGSHSYRQQYLDAARR
GQEFELDTVFNWDGVFGNRLSTRSLWNQRARYFEHGHYRAHESVGGELGDELWSTPLFQA
LKESVSLLGEGDERVFREFDTIVLQGMYGVGRGVKMHDLAESTVLAAATLYPEKPYAEIL
QRHFKRHGLLKAPFISRLESKYITDAKPLSIELVANGRAADVEARLSLQQQILVEKQSQL
TDSFTLSAELPEGLVCGQPFVAQVEADYRHQPWLAKQQWQESITLVRGVPQLVNRAQQMD
VRLNDASTDAQGRFNVGQQIFSQTFLDRDVTIGEQFAIYLDIDHASMADLSVTLTSPKGD
KLVLWNHQISQGNGFKGYFTVAHDAQLAPLLGQQAWGRWRLEIMDSIEGNQGRLNTWGIS
QFEQYQCNETRADSTSKKSGGQLNLFALWALFSIFVARAFCSRQNLS
Download sequence
Identical sequences Q7MFF7
gi|37676023|ref|NP_936419.1| 196600.VVA0363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]