SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676064|ref|NP_936460.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676064|ref|NP_936460.1|
Domain Number 1 Region: 38-288
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.12e-34
Family Pancreatic carboxypeptidases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676064|ref|NP_936460.1|
Sequence length 305
Comment hypothetical protein VVA0404 [Vibrio vulnificus YJ016]
Sequence
MKTHSTYPIGIAGQKWGDEERLAWRQQTHIKREYQLEVVPKILALAEEFELEQYGALSYD
PARYPLYCLKTKAWDESKPTVLITGGVHGYETSGVHGALKFMATETTRYEPYFNLVCTPC
ISPWGYETINRWNPNAVDPNRSFYAQSPAEESANLMRLVATLGPILVHFDLHETTDTDES
EFRPALAARDGIDYIEGMIPDGFYTVADTENPQPEFQAAVIESVSRVTHIAPADENGEII
GSPVIQHGVIHYPMVKLGLCGGVAGCQFGTTTEVYPDSPKVTAQECDDAQVAAIVGGLDY
VITQL
Download sequence
Identical sequences Q7MFB6
gi|37676064|ref|NP_936460.1| 196600.VVA0404 WP_011151790.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]