SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676093|ref|NP_936489.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676093|ref|NP_936489.1|
Domain Number 1 Region: 30-420
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.31e-60
Family Amylase, catalytic domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676093|ref|NP_936489.1|
Sequence length 459
Comment glycosidase [Vibrio vulnificus YJ016]
Sequence
MTKGDVKKMNQAEHALPTSKANVILHAFDWKYADIAKQAQKIQELGYGSVLVSPPLRSAK
SPKWWQRYQPQDYRVIDNALGNTTDFQNMVTELQRCGVWVYADVVFNHMANEAKQRADLN
YPSKTVLEEYMCDPEYYESQRLFGDLSEPLFTEEDFVEAFGIQDWKDKWQVQNGRISGGP
TDPGLPTLRVHEHVITQQRHYLMALKAMGVKGFRIDAAKHMTLEHIKQVWTEDITQGMHI
FGEIITDGGATEEEYELFLQPYLQETRLGAYDFPLFSTLFKAFAPKGSFKSLIDPYCFGQ
ALSNRRAITFVTTHDIPNNDVFANLVLDEENEWLAYAYVLGRDGGTPLIYTDLDTSGILN
QNGQPRWKDAWHDPRMVQMIAFHNRFHGEPMTVLEGNDDMLVFSRGERGFVVINKSARKQ
TISLPLARPLQDMLTGKHFLPMNGKIDIVVAAKTALMMC
Download sequence
Identical sequences Q7MF87
196600.VVA0433 WP_011151810.1.16238 WP_011151810.1.34622 WP_011151810.1.67868 gi|37676093|ref|NP_936489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]