SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676108|ref|NP_936504.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676108|ref|NP_936504.1|
Domain Number 1 Region: 4-166
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.52e-52
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 166-289
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.67e-39
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676108|ref|NP_936504.1|
Sequence length 291
Comment 3-hydroxyisobutyrate dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MDVKKVAFIGLGVMGYPMAGYLSKAGYETRVYNRTFAKAQKWAEQYQGAAFETPREAALG
CDVVFVCVGNDDDVRSVVYGEDGVLAGLEPGAILVDHTTTSAELAVELADACQKVSNAFI
DAPVSGGQAGAENGVLTIMCGGDESVFAQVSPVMDAYAKQATLLGENGQGQRCKMVNQIC
IAGVLQGLSEAILLAQKSGLDVAQVVDTLKHGAAGSWQMENRATTMAQDKFDFGFAIDWM
RKDLGFCLKEAQRVGLELPLTKQVDQQYAQLQQDGLGRMDTSVLIKAVAKH
Download sequence
Identical sequences A0A1W6M9C7 Q7MF72
gi|27367978|ref|NP_763505.1| 196600.VVA0448 216895.VV2_1637 WP_011082478.1.17874 WP_011082478.1.34622 WP_011082478.1.55006 WP_011082478.1.90288 WP_011082478.1.93668 WP_011082478.1.9921 gi|37676108|ref|NP_936504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]