SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676142|ref|NP_936538.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676142|ref|NP_936538.1|
Domain Number 1 Region: 39-146,201-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-38
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676142|ref|NP_936538.1|
Sequence length 490
Comment hypothetical protein VVA0482 [Vibrio vulnificus YJ016]
Sequence
MIIAKENPMRNVNATKQSGSPSNHSHPSFWFKQAIEQEQPPSAKPLQGQLETDVLIVGGG
YTGLWTAIMLKEQAPEKQITVIEKGLCGSGASGANGGCMLTWSTKYPTLKRLFGEDHAKW
LVEQSEQAVLDIEAFCQQHQIDAQLSSKGVYYTATNSAQKGALQPVVAELERLNINSWRH
CEQHELATHSGSPRNVDGHYSAIAATVQPAMLARGLRKVAIEMGVQIYENTPMTALAYGE
PAKVTTPQGEIYAQQVVLALNAWMVEQFPQFKRSIVVVSSDMVITQPLAPEALADAGWKA
GSSVLDSRIFVHYYRDTVDGRLMLGKGGNHFSYNNAVEPMFQRATRYQDLLRRSFDKLFP
SLKGEEFAYSWTGGSDRSATGFPFFDRLAGQSNVFYGFGYSGNGVAQTRMGGKILSSLVL
GIENEWSQCGLAKGPLGQFPPEPFRWLGAMMVRNAVRRKEEAEDNEQTPWLWDKWLAKLA
GPAGKADKLE
Download sequence
Identical sequences Q7MF38
WP_011151853.1.34622 196600.VVA0482 gi|37676142|ref|NP_936538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]