SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676168|ref|NP_936564.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676168|ref|NP_936564.1|
Domain Number 1 Region: 1-290,473-534
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.59e-89
Family FAD-linked reductases, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 292-474
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.22e-63
Family GMC oxidoreductases 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676168|ref|NP_936564.1|
Sequence length 560
Comment choline dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MQQHYDYIIVGAGSAGCVLADRLSESGDHSVLLLEAGGSDKSIFIQMPTALSYPMNSEKY
AWQFETDAEADLDGRRLHCPRGKVLGGSSSINGMVYVRGHACDFDEWEEQGAKGWNYQAC
LPYFRRAENWIDGEDEYRGGDGPLSTCAGNKMTLNPLYRAFIDAGKEAGYPETSDYNGYQ
QEGFGPMHMTVKNGVRASTSNAYLSRAKKRSNFKLIKGVVVQRILLEEKRAVGVEFELAG
ELRTCFAKNEVISSAGSIGSVQLLQLSGIGPKTVLEKAGVTPVYHLPGVGQNLQDHLEVY
FQYHCQKPITLNGKLDWFSKGLIGTEWILTRKGLGATNHFESCAFIRSRAGLKWPNIQYH
FLPAAMRYDGQAAFDGHGFQVHVGPNKPESRGRVEIVSANPLDKPKIQFNYLSTERDRQD
WRDCIRLTREILAQPAMDEFRGEEIQPGINVATDAEIDQWVKENVESAYHPSCSCKMGAD
DDPMAVLDEECRVRGITNLRVVDSSVFPTIPNGNLNAPTIMVAERAADLILHKQPLPPQR
SKVWLAPSWETQQRTGEPMR
Download sequence
Identical sequences Q7MF12
196600.VVA0508 WP_011151879.1.34622 gi|37676168|ref|NP_936564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]