SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676177|ref|NP_936573.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676177|ref|NP_936573.1|
Domain Number 1 Region: 21-242
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.54e-17
Family Reprolysin-like 0.027
Further Details:      
 
Domain Number 2 Region: 288-408
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000106
Family Proprotein convertase P-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676177|ref|NP_936573.1|
Sequence length 409
Comment hypothetical protein VVA0517 [Vibrio vulnificus YJ016]
Sequence
MKRTLLAFAIASGIAVPAVAETTQIDVLGVYTKATSEWFEQDQLAAIQHRFNVGNLILKN
SGLDIKVNLVATKEYNFDSQAGMKKSQEQALDAMTPSRAQDPIFSDIESERKKAGADMVA
MFRNLDLKNTPDYDAKEGLISCGLAWVIPASNWRSNPRYAKSRMYSHSYMNQCGDDTFIH
ELGHNWGLNHAHEQYSNTPHFRNGTEKDAYGYGVKNKFATTMAYGFLFGVRGRSYTFSTP
DKQCEGTPCGKKDYANAVRAIGLSAPHVANIYASKAATPDDGTTDTVTPPTATTGKNQYL
LESPRALPDATELELPFDVNYQGELTKATIRVNIEHQFIGDVSVSLVAPSGKQWSLKESN
GRDRGNRYHVLFTLDDVEKSDVLGQWKVLVSDDYEKDTGIIKEVELLFK
Download sequence
Identical sequences Q7MF03
196600.VVA0517 WP_011151886.1.34622 gi|37676177|ref|NP_936573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]