SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676180|ref|NP_936576.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676180|ref|NP_936576.1|
Domain Number 1 Region: 1-36,94-103,143-191,258-428
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-21
Family HI0933 N-terminal domain-like 0.059
Further Details:      
 
Weak hits

Sequence:  gi|37676180|ref|NP_936576.1|
Domain Number - Region: 69-124
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.0213
Family Cryptochrome/photolyase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676180|ref|NP_936576.1|
Sequence length 438
Comment anaerobic glycerol-3-phosphate dehydrogenase subunit B [Vibrio vulnificus YJ016]
Sequence
MLNYDIAVIGGGIAGYCAALNAIEAGKKTVLISQGQSALHFSSGSIDVMAKTPSGERVEA
PFSAMASLPQQHPEHPYSKMSPNFVRQSLYWLVDQLKEQGLPLHCQQDESNHHRITPLGT
LKATWLSQPFVYQHRQNVAFKRLLFVAVDGYRDFQPLLAKDNLKKHPDFQHCEIGEIQVT
IPGCEALRRNPNELRSIDIARLLKQPQAFNSLCHQLMKHATQEDLVIMPAIMGNGDGLVL
LQQLRRQTNLTLHEVPTMPPSLLGIRIEEALQKRFLKQGGVLLKGDQVLSGEWDAQGHLV
SISTRNLGDIPLHANAYILASGSYFSQGLKASLDKIVEPIFGLDMVAKPHRRQWRNDQFF
SASAHPFMAFGVETDAMFRPSLNGQVCQNLYCCGSVLSGYDPVFEGSGGGVAVSTALAAV
QRAMGLKQAMSVEEECVL
Download sequence
Identical sequences Q7MF00
WP_011151888.1.34622 196600.VVA0520 gi|37676180|ref|NP_936576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]