SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676195|ref|NP_936591.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676195|ref|NP_936591.1|
Domain Number 1 Region: 792-1012
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.00039
Further Details:      
 
Domain Number 2 Region: 296-495
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.89e-31
Family Multidrug efflux transporter AcrB transmembrane domain 0.00077
Further Details:      
 
Domain Number 3 Region: 138-184,272-324
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.2e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0036
Further Details:      
 
Domain Number 4 Region: 41-137
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.32e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0055
Further Details:      
 
Domain Number 5 Region: 187-269
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000288
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0079
Further Details:      
 
Domain Number 6 Region: 711-788
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000602
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0091
Further Details:      
 
Domain Number 7 Region: 557-651
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000262
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676195|ref|NP_936591.1|
Sequence length 1016
Comment AcrB/AcrD/AcrF family transporter [Vibrio vulnificus YJ016]
Sequence
MNLAGYTIAKRTSVWVLIALTLLGGYISYLKLGRFEDPEFVIRQAVINTPYYGATAQEVS
DEVTDLIEGAVQSLQELKEVKSVSKQGMSEVTVEIKLEFAQSSAELQQVWDKLRRKISDV
QRQLPPGAGPSIVNDDFSDVYALFFAVTGEGFSDKQLQDYVDTLRRDLVLVPGVAKTATL
AEQQETIFVEISSERLKQLGMSLEKVTQVLQKQNLITVAGSIETEAMRLPVIPNSSIRSL
QDIRNLQVGLGADNKVIRLGDIANVVRGYQEPATMLMRYNGQRAVGFGISNVMGGNVVEM
GDAVKARLVELENQRPLGMELHVISMQSDSVRASVANFIDNLIAAVAIVFVVLLLFMGVR
SGIIIGFVLLLTVAGTLCIMLIDDIAMQRISLGALIIALGMLVDNAIVVTDGILVRMQQE
PDSDKLTIVNEVVEATKWPLLGGTVVGICAFSAIGLSPSDMGEYAGSLFWVILYSMLLSW
VFAVTITPMLCHDFLKVKPNQGDNSVGVMMRSYRGLLSWVLRHRLISVVAILAMLLTAVW
GAKFIPPGFMPDSQRAQFVVDVYLPQGSDIRRTEQVVAQIENEVKSKQGVTNITSFIGGG
GLRFMLTYSPEARNTSYGQLLIDIDDYQKIAALLPELQNELDAKYPDASIKVWKFMLGRG
GGKKIEAGFQGPDSAVLRGLAEQAKALMLADDNLIAVQDDWRQQMPVVKPVYSSEKAQRY
GLTNQEINQAISQTLSGKNVGVYREGDDLIPIVLRAPKEERQHARAIENTLVYSHAVGQS
VPVSQLIESVDVVWQDAILRRIDRVPTILVQADPAPGVLTADAFNQIRSKIEAIPLPAGY
ELTWYGEYKASKDANEGLVISAPYGFSAMILSVIFMFNALRQPLVIWLTAPLAVIGVTVG
LIVFQTPFEFMAILGFLSLIGMMVKNAIVLVDQADVEIRQGKWPFQAIIDAAMSRARPVL
LGALTTILGVAPLLVDPFFKSMAVTIMFGLLFATLLTLVVIPLFYAMLFRIKVEQM
Download sequence
Identical sequences Q7MEY5
WP_011151900.1.34622 gi|37676195|ref|NP_936591.1| 196600.VVA0535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]