SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676197|ref|NP_936593.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676197|ref|NP_936593.1|
Domain Number 1 Region: 193-502
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.52e-74
Family Thermolysin-like 0.000000722
Further Details:      
 
Weak hits

Sequence:  gi|37676197|ref|NP_936593.1|
Domain Number - Region: 140-212
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.068
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676197|ref|NP_936593.1|
Sequence length 608
Comment Zinc metalloprotease [Vibrio vulnificus YJ016]
Sequence
MKCAVLRSYGGNKMDFTLEAFMTFKTTIIATCLLAAAPLSMAANGPNAHPSPSLKGLQAK
NFVLPDNATLVKRFALGHSGMETQRFQQHFQNAIVFGGEISLITAASGDVVAVIGRRYDH
LLSSNSVKLKAEAAKGIVMMKIGGHGRWTTNLFINPSNGLFFYIVENQRADSRWHYWIDA
ETGEVLNAYDGLTTGSGTGVHGDSKDLSGLTTFNRGNFEMVSANGRLSTYDAGGRSRLPG
DLATDSDDQWVEPGHTSPGQAAMVDAHFFANVTDSYFLSVLQFNWLNHYSQGMVSTAHVK
RNYNNAYWNGYQMAYGDGDGISFINLSGDLDVVGHELSHGLTDATSDLIYQNESGALNEA
FSDIMGTNIEFYYGSGNWTIGEDITPNSNGIRNMADPGEDGDPSHYNERYTGTGDNGGVH
INSGIINHWYYLLVNGGQNSDGQFASGTDVAGIGLDAATQIVYNGFTSLPPNADFCLARA
ATDAVAGTHSANVLDAWDEVGVSSDLCAGGGDGGGSGTGGDITISNVSSRVIKGVKFQIS
WDTDVASSTEVTFSCCGTYVKNEQVTSHSYNFNGSKGVAYEYYITSKVYDSAGNVASSAT
AGPFIHQN
Download sequence
Identical sequences Q7MEY3
196600.VVA0537 WP_011151902.1.34622 gi|37676197|ref|NP_936593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]