SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676230|ref|NP_936626.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37676230|ref|NP_936626.1|
Domain Number - Region: 41-141
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.00194
Family Dehydroquinate synthase, DHQS 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676230|ref|NP_936626.1|
Sequence length 328
Comment ribose ABC transporter permease [Vibrio vulnificus YJ016]
Sequence
MSSEIMSKRKSNETNKTWISKEWLIEQKSLIALLFLIVVVSFLNPNFFTVDNILNILRQT
SVNAIIAVGMTLVILTAGIDLSVGSVLALCGAFAASLVAMEVPVLIAVPTALLAGASLGA
ISGVIIAKGKVQAFIATLVTMTLLRGVTMVYTDGRPISTGFTDTADAFAWFGTGYALGIP
VPVWLMVVVFAAAWYLLNHTRFGRYVYALGGNESATRLSGINVDKVKIGVYAICGLLAAL
AGIIVTSRLSSAQPTAGMGYELDAIAAVVLGGTSLMGGKGRIMGTLIGALIIGFLNNALN
LLDVSSYYQMIAKAAVILLAVMVDNKNK
Download sequence
Identical sequences Q7MEV0
WP_011151930.1.34622 196600.VVA0570 gi|37676230|ref|NP_936626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]