SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676248|ref|NP_936644.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676248|ref|NP_936644.1|
Domain Number 1 Region: 276-360
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000118
Family Zinc protease 0.031
Further Details:      
 
Weak hits

Sequence:  gi|37676248|ref|NP_936644.1|
Domain Number - Region: 782-878
Classification Level Classification E-value
Superfamily PKD domain 0.0902
Family PKD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676248|ref|NP_936644.1|
Sequence length 1286
Comment hypothetical protein VVA0588 [Vibrio vulnificus YJ016]
Sequence
MSLKIKKAKIGIAISSLLSSISLNATTLPSPDWHEFTMSDGSVREMRLMGNQALAWYQDR
EGTIYLYQGDTWYYGKYAEFDGEGRVVSTDVVVTQASQSPAASNSSLHPVKPARISFDEG
YSSDINTTEHHAVALRIRQADQPVTQPLLVVQVSFNDEVMVNDFTNRIFGQDGQSVRDYF
LKNSYNKYVVTPARETQGTANDGVINISLDMAHPDCHSKEDNTCTTRQRAIFTAAYAELD
QYIDLSTYDSNGDGFIKPSELSVMFVFAGYDAAAGGNRRPYIWPHKFAHNNETIDGVTIN
AYCLFADFQGDHQSTMGVIAHELGHLMLGLPDLYSYEHDGSIGHWGLMGGGSWGRKPGDL
YSGDTPVNMTAWSKEASGFLEPDVLNSNQSYTVNTSQGESVIYLDPYLQKMGPRLYLQNR
RKVDYDRALQGEGLLATSVVIDNKFNSTGPMQVQIFQADGLDELNAGGWSDNGDVFPGSS
NVTLLSDDSTPSLRLNTAGRNTGITISDIVSTNQHSTLTLQLPDQRGKHAWMTSFARQYT
QYDRRINALGFAVDVHFENTSLDGIHFYAQKSDQTQPMEYKVTKYPYQTNWRGDVTFKAE
DGVEIARGQLNSDGGRAMFPQPFALTQERHLIVVELTNAIPEFSTSYYDAYLSDGIRKEQ
FYADNTTLQGGRMNSSRGRNFPFAALLQTQVNPLPQALDDQFQVTQGQSVQLNLMNNDTN
LMPGHSFQVELMTQPSKGTVNGKEYQADLGAEGVDEFQYRLRDSEGNVSNTAKVSVTVLA
INKPPVISAKVVNDVVYVGGLVELSVDKVEDEDSKAFSYQWQQISGPKVTLRNGQQKTSS
FVVPEGVTASDVMQFKVTVTDDAQNEVSQNVEVTVNNHQPEAQNDHGQIKAGEVKRFRVL
DNDIEKDGERLTLTRIVSQQGLGKASLSGNEIEFSAPATFGSETSTTVTYEIKDPQGLMS
QATLIIQFVKPKTLVIDNITLEGREDESVILNLQQLAGKGGEVKIVELPKNGLIHNGQYV
PQANFAGKDSFTFQVTNAEGTTSNIATVSINILPVNDLHTFRVKASKLQVSADERIELSV
VQLKDIDSSNHQFNWKQVSGRKATILNADKSVAIVVIPSQSVGNEKLVFSATVRDEQGEA
VTHSLTLTVHASTPSVKQGKLKLKFGNSLNVKPLESEYKGKFQLRITRPAEHGEVQIVNQ
ELIYQAPSQTALTMIDRFNYEVLFDNGESKQGWFEIELSPTSTISGQNDDSDNPPTGDTG
GEDAGSLGFGSAWLMAFVLLWRRRKS
Download sequence
Identical sequences Q7MET2
196600.VVA0588 gi|37676248|ref|NP_936644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]