SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676361|ref|NP_936757.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676361|ref|NP_936757.1|
Domain Number 1 Region: 795-1015
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.1e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.0005
Further Details:      
 
Domain Number 2 Region: 292-491
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.62e-37
Family Multidrug efflux transporter AcrB transmembrane domain 0.00039
Further Details:      
 
Domain Number 3 Region: 136-182,270-325
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0021
Further Details:      
 
Domain Number 4 Region: 40-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.75e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.003
Further Details:      
 
Domain Number 5 Region: 184-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000034
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.01
Further Details:      
 
Domain Number 6 Region: 708-788
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000109
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.006
Further Details:      
 
Weak hits

Sequence:  gi|37676361|ref|NP_936757.1|
Domain Number - Region: 557-643
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000837
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676361|ref|NP_936757.1|
Sequence length 1019
Comment AcrB/AcrD/AcrF family transporter [Vibrio vulnificus YJ016]
Sequence
MSIAEYSIKNKVISWLFIVILAIGGVTSFLELGRLEDPAFTIKDAMVIATYPGATSKEVE
EELTYPLEKEIRKLPYIDKITSTSSNGLSQIMVSMKMDYGPDELPQIWDEMRRKINDLQP
SLPQGVQSLQIIDDFGDVYGVMLMLTGDDYDYVELKRYADQLTRELELIDGVGKVDIAGD
QQEQLFVEISLDRLAALNLDMNVISGLLNKQNNVVSAGEVMVNGESLMIRPSGTLNTVDA
LENLIIHGRDTGNLIRLKDVATITRGIQEKPGNVLLFNGKKAINIGVSFASGVNVVEVGQ
RIEAELASLESIKPAGIDMSYFYNQAQEVDDSVKAFVISLAEAVAIVIIVLLFTMGLRSG
VIIGLVLLLTVFGTFILMNHYDIELHRISLGALIIALGMLVDNAIVVVEGILVGLKKGRT
KIQAATDIVKQTQWPLLGATVIAITAFAPIGLSQDATGEFMGSLFWVLCFSLFLSWITAI
MLTPFLADLLLKEQDKTLAADEEDPYKGWLFVAFGASLKWALRFRWLTVAGMVALLIGAV
VAFGHVKQQFFPPSNTPMFYVDMWMPEGTDIRETMKQASEVESYIRQQANIDFVSASIGQ
GLQRFALTYEPAKNYEAYAQFQVRTTDRDTMFVLLNELDSRLAKTFDKPTFQLKLMEFGP
SPASKIEARITGPDPQVLRALAVQVEDILHTDPGARNIRHDWRERTKQIVPIFNESKARR
LGISKEDLSSTLQMSFGGSTLGLLRDGTHILPIMVRLPETERVDFESLQNVSIWSPSLQS
YIPVDQIIDGVTLDWEEPLIQRRDRKRTLTVLADHDVLSEDTAASLFARVQPKVMALPIP
HGYEITWGGEYESSKDAQEGLFGSLPMGYLLMFIITMLLFNSFKKPLVIWFTVPLSIIGV
AFGLLATNMPFSFTAFLGLLSLSGMILKNGIVLLDQINLELDSGKDPYLAIIDSAVSRVR
PVSMAALTTILGMIPLVFDAFFGSMAITIMAGLGFATVLTLVVVPVMFAILFGIKPAKS
Download sequence
Identical sequences Q7MEG9
gi|37676361|ref|NP_936757.1| WP_011152040.1.34622 196600.VVA0701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]