SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676380|ref|NP_936776.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676380|ref|NP_936776.1|
Domain Number 1 Region: 315-628,753-785
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.49e-75
Family Type II chitinase 0.0000636
Further Details:      
 
Domain Number 2 Region: 22-87
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 1.1e-17
Family Carbohydrate binding domain 0.0047
Further Details:      
 
Domain Number 3 Region: 628-751
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000763
Family Chitinase insertion domain 0.0084
Further Details:      
 
Weak hits

Sequence:  gi|37676380|ref|NP_936776.1|
Domain Number - Region: 191-282
Classification Level Classification E-value
Superfamily PKD domain 0.00589
Family PKD domain 0.02
Further Details:      
 
Domain Number - Region: 99-184
Classification Level Classification E-value
Superfamily E set domains 0.077
Family Class II viral fusion proteins C-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676380|ref|NP_936776.1|
Sequence length 1060
Comment chitinase [Vibrio vulnificus YJ016]
Sequence
MRFKNGKAAKNVFTLSTLTASCLMAFNSYAAVDCSPLQEWNSSAIYNGGDKVQYQGSAYE
ARYWTQNNNPAEFSGDWAQWKALGACDNGPVDPVNQVPTTALTSPVATDVVKEGEVVVLA
ATAADQDGTVAKVEFLVDGVVVGQDTSAPFSASWTATAGAHTFSSVAYDDKGAVSQPSNV
TLTVESTQPGNTAPTVDLALSATTVEQGAVVTLTSNAADSDGTVEKVDFFVGGVLVGTAA
TAPYTLDYTTTQAGSLSVFARATDNLGATTDSSAQTLKVNGVAPVASCRPDGLYQTEGVN
VPYCTIYDEEGREKMGADHPRRVIGYFTSWRSGDDPQAAYLVKDIPWEQLTHINYAFVSI
GSDGKVNVGDVNDPTNAATGKEWPGVEIDPTLGFKGHFGALATYKEKYGVKTLISIGGWA
ETGGHFGADGKRVADGGFYTMTTNADGSINHAGIEKFATSAVEMIRKYKFDGVDIDYEYP
TSMAGAGNPDDKAFMEPRRAYLWASYQELMRVLREKLDQASAQDGVHYMLTIAAPSSGYL
LRGMETFDVTKYLDYVNIMSYDLHGAWNDHVGHNAALYDTGEDSELAQWNVYGTAQYGGI
GYLNTDWAYHYFRGSMPAGRINIGVPYYTRGWQGVTGGTNGLWGRAALPNQAECAPGTGE
GEKNNCGHGAMGIDNMWHDTDPKGNEMGAGSNPMWHAKNLEKGIFGSYASAYKLDPVNDP
QDKLVGSYVRNYDSVAVAPWLWNAEKAVFLSTEDKASVSVKADYVIDKEIGGIMFWELAG
DYNCYVLDANGNRTTIDETEQACATGNGEFHMGNSMTKAIYDKFKSATPYGNTVATGAIP
SETLDIAVSVGGFKVGDQNYPINPKVTFTNNTGTAIPGGTEFQFDIPVSAPDNAKDQSGG
GLKVIASGHTRANNIGGLDGVMHRVAFSLPAWKELPAGGTYELDMVYYLPISGPANYSVN
INGVDYAFKFEQPDLPVADLSAGNGGNTGGGDTGGGNTGGGDTGGNTGSGTVIQWEPGVT
QVNNGETVTFNGKCFVAKNSPGVWESPTQTNWFWDEVTCP
Download sequence
Identical sequences Q7MEF0
196600.VVA0720 gi|37676380|ref|NP_936776.1| WP_011081192.1.17874 WP_011081192.1.34622 gi|326424196|ref|NP_762195.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]