SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676397|ref|NP_936793.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676397|ref|NP_936793.1|
Domain Number 1 Region: 292-398,430-464
Classification Level Classification E-value
Superfamily CBS-domain pair 1.59e-21
Family CBS-domain pair 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676397|ref|NP_936793.1|
Sequence length 483
Comment formate transporter 1 [Vibrio vulnificus YJ016]
Sequence
MSVATSENTQYFSPKEMMAEAEKFALSKANKTSAMTLGLAIMAGAFIGLAFLFYITVTTG
SANAGWGLSRFAGGLAFSMGLILIVICGGELFTSSVLSSISWANKQISFTKMLAIWGKVY
IGNFIGAMFLLLLVTGAGLYQMDGGQWGLNALNIAQHKLHHTTIQAFSLGVLCNLLVCLA
IWLTFSSANAMTKAVMTMLPVAMFVSSGFEHCVANMFMVPLGIVIANFAPDAFWAQVGAN
ASQYADLNVGHFITANLIPVTLGNIVGGAVLVGLANWCIYRRPELKAAKISTITQTTHIT
SVKEFTMKNAAVVRDIMDAQPVVLGVEMPIATALDTLLDNHIISAPVVDIEGRLVGFLSA
HDVMVDLWCQDYLPSTGQKVVDLMSRDVVAIDVNDRLVDVVEFLCIDKEQLYPTSSMGIA
TRMTSLSLEERAKSMKVNKPHVLPVLENGKFAGVVSRQEVLNALRPIYGERLNLVETRQL
ETA
Download sequence
Identical sequences A0A1W6MA51 Q7MED3
gi|37676397|ref|NP_936793.1| 196600.VVA0737 WP_011152070.1.21633 WP_011152070.1.22778 WP_011152070.1.25536 WP_011152070.1.34622 WP_011152070.1.55006 WP_011152070.1.90288 WP_011152070.1.93668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]