SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676420|ref|NP_936816.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676420|ref|NP_936816.1|
Domain Number 1 Region: 4-463
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.74e-159
Family Amylase, catalytic domain 0.0000000000556
Further Details:      
 
Domain Number 2 Region: 466-543
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.75e-20
Family alpha-Amylases, C-terminal beta-sheet domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676420|ref|NP_936816.1|
Sequence length 544
Comment glycosidase [Vibrio vulnificus YJ016]
Sequence
MENKWWHDAVVYQIYPRSFCDSNNDGIGDLNGIISKLDYLKTLGVNVLWLSPVYKSPMDD
NGYDISDYQDIAAEFGTMADMQNLLDQAKARDIRIVMDLVVNHTSDEHPWFVEARKSKDN
PYRDYYIWRDAKPDGSVPDDQGSIFGGSAWQWDEATQQYYFHLFSKRQPDLNWENPKVQQ
EVHKMMNWWIDQGIGGFRLDVIDLIGKEIDKGITGNGPRLHPLLQEMNRATFGDKDLLTV
GETWGATPEIAKLYSDPERHELSMVFQFEHITLTWQHGDKWNPIPLDLKQFKHVLTKWQT
ELSNQGWNSLFWNNHDLPRVVSKYGDDQRYRVESAKMLATALHFLKGTPYVYQGEEIGMT
NVAFESLEQYKDIETLNFYKVKTESGVSHQHMMDAIHENSRDNARTPMQWSASQNGGFSQ
AKPWIEVNPNYPEINVEQALADSDSIFYHYQKLIELRKQHPAIVYGDFTPLFAEHDSVFA
YVRSHQDEQLLVINNFSDQDVSLALPDNLQNKEVNCLIYNYDSLDMLGVTLSLKPYQCYA
FKLR
Download sequence
Identical sequences Q7MEB0
gi|37676420|ref|NP_936816.1| WP_011152090.1.34622 196600.VVA0760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]