SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676435|ref|NP_936831.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676435|ref|NP_936831.1|
Domain Number 1 Region: 11-59,135-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.7e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676435|ref|NP_936831.1|
Sequence length 481
Comment hypothetical protein VVA0775 [Vibrio vulnificus YJ016]
Sequence
MNKLNTPNCDTHIAVVGGGVAGATAAIHFSELGYKVTLLEKGPSLVNGPPICHLHAGGNL
YREISTEQCIELLRQSIESVRLFPHSINIRPTVIAIPHSDDGEPNDLLPRLAAVATEYKA
LVEQDCRNQVLGKPEDYYKLYSRDQLAALASMTQPKNPRSMDEWMIPFAKHADLNSLKYP
VVMVQEYGWSVFRLSAIASLALDKFPATEVRCNSELQTCQWDGKQWQLTLSNTSQPLTVD
YLVNACGFETGTLDDHIGVKTQRLVEFKAAYVTQWSKCNEEWPEVIFHGPRGTPQGMAQL
TPYGDGYFQLHGMTQEITLFKDGLVSSEEGSSQPRLPLQYVKKIQQGWNKEILISRTQGA
IEHMSQFVPTFSDAQAAGKALFGAQQIPGNDVTLRAADVSFSANNYACIEIVKASSTLQA
AQKTAQHWFGVTPSFDIEGQHPVTLTLSPQEIEEKAIELAQLRGYPVALAKTTGEGLYKN
L
Download sequence
Identical sequences Q7ME95
196600.VVA0775 WP_011152103.1.33883 WP_011152103.1.34622 WP_011152103.1.67868 gi|37676435|ref|NP_936831.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]