SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37676483|ref|NP_936879.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676483|ref|NP_936879.1|
Domain Number 1 Region: 24-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.39e-58
Family Phosphate binding protein-like 0.00000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676483|ref|NP_936879.1|
Sequence length 251
Comment molybdate ABC transporter substrate-binding protein [Vibrio vulnificus YJ016]
Sequence
MMNKWLSLLLLLLAPAVSAQQTTRVYAASSLTNAINDVIESYERQNHQKVQAIYGGSSSL
SRQLLSGAPGDIFISANNQWMDYLVQHEVIKRDSVTNLLSNKLVVITNKNNNVALDVSSK
AQWQRLLTDNWLALGDTNSVPAGMYAKQMLQNADVWNAVSSHVAPSKNVRLALALVERDE
AKLGIVYQTDARMSQKVKILVTPEQALYDPITYPAGLISQSQSAKAFFNYLMGPEATAIF
QKHGFTTLEKP
Download sequence
Identical sequences Q7ME61
196600.VVA0823 WP_011152136.1.34622 gi|37676483|ref|NP_936879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]