SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676557|ref|NP_936953.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676557|ref|NP_936953.1|
Domain Number 1 Region: 835-1062
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.23e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.00024
Further Details:      
 
Domain Number 2 Region: 320-518
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.94e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.00024
Further Details:      
 
Domain Number 3 Region: 62-153
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.01e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0043
Further Details:      
 
Domain Number 4 Region: 209-290
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000314
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0087
Further Details:      
 
Domain Number 5 Region: 582-696
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000023
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0077
Further Details:      
 
Domain Number 6 Region: 164-206,293-351
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000068
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 
Domain Number 7 Region: 746-830
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676557|ref|NP_936953.1|
Sequence length 1064
Comment AcrB/AcrD/AcrF family transporter [Vibrio vulnificus YJ016]
Sequence
MIELPRTSSTSKVNSMDTRLGISGRIAAAFQHSAMTPLLALVGLLMGLFAVIVTPKEEEP
QIDVTFADVYIPFPGASPQEVASLVTTPAEQVISEIQGIDKIYSFSQPDGAMIVAIFDVG
VTRNDAVVRIYNKLYSNKDWMPQGVGVGEPVIKPRGIEDVPIVTVTLSDKSGHYTGQQLT
QIAHGLETELKRIEGTRDIYTVGAHSTIVDVRLDPVKMNAYGISISQLNQVLPSANRRSA
MLSLTHDNQQIPLQIGEFLTHVDQIKQLVVGVANGAPVYFSDIADIELGVNTPTQNVWTS
DKQGLYPAVTLAIAKKGGENAVDVAQTIEDRLEVLKNQLIPHDVDIAITRDYGKTAADKS
NTLIGKLAFATTAVVLLVLLTMGWREALVVGIAIVVTLMITLFASWAWGFTLNRVSLFAL
IFSIGILVDDAIVVVENIHRHMSMGKKKLAELIPVAVDEVGGPTILATLTVIAALLPMAF
VSGLMGPYMSPIPINASMGMLISLAVAFVVSPWLSGKLLKSGQHEESHKADSIFHKIMSP
FITARAQGRNRFLLLLGIVGLIAASVALPVMQAVVLKMLPFDNKSEFQVVLDMPEGSSLE
KTQRVLFEMAQSLNDVPEVSDYQIYVGSAAPINFNGLVRHYFLRNQAHQGDIQVNLLDRR
ERDRDSHEIASSVRPMLNQIASQFGGKVKVVEVPPGPPVWSPILAEVYAPTAELRAEAAR
QVRDIFRETQDIVDVDMYLPEIHQKWQVVIDRSKSANLMVPYSDIVDALATAVGGKPITY
LHAEHSKYPIPVMIQANESAKVRLEQVLNMQVVSQTGNRYPLSELVSIRQTKMEDYIVHK
NLVPMVMVVADMTGETDSPLYGMAALSGTLSERMPLEQYFIHQPDGLQGISIMWDGEWTI
TYETFRDMGIAYAVGMVLIYLLVVAQFKSYLVPLIIMAPIPLTIIGVMPGHALLGAQFTA
TSMIGMIALAGIIVRNSILLVDFINQQVEEGVEFAEAVMQSAAVRAKPIMLTALAAMIGA
VFILDDPIFNGLAISLIFGIFVSTILTLIVIPVLYYAAMKKRFV
Download sequence
Identical sequences Q7MDY8
gi|37676557|ref|NP_936953.1| 196600.VVA0897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]