SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676563|ref|NP_936959.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676563|ref|NP_936959.1|
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.3e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0029
Further Details:      
 
Domain Number 2 Region: 344-466
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.28e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00042
Further Details:      
 
Domain Number 3 Region: 155-341
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.1e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 
Domain Number 4 Region: 459-562
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.16e-25
Family Multidomain sulfurtransferase (rhodanese) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676563|ref|NP_936959.1|
Sequence length 567
Comment NADH oxidase [Vibrio vulnificus YJ016]
Sequence
MTKIVIVGGVAGGASAAARARRLSEDAQIIMFERGPFVSFANCGLPYHIGGDIKERSKLL
LQTPESFLARFNVDVRVMNEITAINRHEKTVTVKNLIDGSEYAESYDFLLLSPGAGPVVP
PIPGIDNPLTHSLRNIPDMDRIIQTIQTNNVEHATVVGGGFIGLEMMEAFHQLGIKTTLL
ELADQVMTPVDREMAGFAHGEIRAKGIDLRLGTALSSVEYIANDHVASENAGEDIQHQHI
SGHLALSLSTGDTLNTDVLIMAIGVRPETKLAQQAGLQIGELGGIYTNDMMQTSDPSIYA
VGDAVEEKDFVTGKQTLVPLAGPANRQGRMAADNMLGRSERYQGTQGTAICKIFDLAVAS
TGKNEKQLKRDGVEYEKVYVHTASHASYYPGAEIVSFKMLFDPKTGKIFGAQAVGKDGVD
KRIDVMAVAQRAGMTVEQLQHLELTYAPPYGSAKDVINQAAFVANNLIKGDAKAIHFDEI
EHLNDDQLLLDVRNPGELQAGGYLPGAINIPVDQLRQRMDELPKDKEIIIYCQVGLRGNV
AYRQLVNNGYKARNLLGGYRTYMFSKC
Download sequence
Identical sequences Q7MDY2
WP_011152210.1.34622 196600.VVA0903 gi|37676563|ref|NP_936959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]