SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676587|ref|NP_936983.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676587|ref|NP_936983.1|
Domain Number 1 Region: 634-809
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.87e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0032
Further Details:      
 
Domain Number 3 Region: 503-629
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 
Domain Number 4 Region: 144-311
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.38e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|37676587|ref|NP_936983.1|
Domain Number - Region: 347-401
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00167
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676587|ref|NP_936983.1|
Sequence length 853
Comment NAD(P)H-nitrite reductase [Vibrio vulnificus YJ016]
Sequence
MSKLKLVIVGNGMVGHRYIEDLVDKTDVSNYDITVFCEEPRVAYDRVHLSSYFSHHTADE
LSLVKTGFYEKHAIKVLLGERAININREKQTVYSSSGREIQYDKLILATGSYPFVPPIKG
NESKDCFVYRTIEDLKAIEACAKKSKSGVVIGGGLLGLEAAGALKALGMETHVVEFAPKL
MAEQLDQAGGDQLRQKIERMGVKVHTSKNTLEIAAEGEQARNVMRFADGTELETDFIVFS
AGIRPQDKLARQMGLGIAPRGGIEINDHCQTTDNNIYAIGECASWNKMFYGLVAPGYKMA
TVAVDHLLGNIDSKFEGADMSAKLKLLGVKVGSIGDANGRTPGCKSYVYQNEELEVYKRL
IVSPDNKKLLGAVMVGDTSDYGDLLQLMLNEIELPQHPDTLILPAHAGAEKPKLGADSLP
DSAVICSCFDVTKGKIAQAVADGHHTIGDIKAVTGAGTGCGGCIPLVTSVLNAELAKAGV
EVKSDICEHFAYSRQELFHLIRIEEIKTFDELLAKHGKGYGCEVCKPAVGSILASCWGEH
ILKPQLVKLHDTNDNFLGNMQKDGTYSVIPRMAGGEVTPQALKVLAEVAAEYNLYTKVTG
AQRIGLFGAQKDDLPAIWKKLIAAGYETGQAYAKALRMAKTCVGSTWCRYGVQDSVGLGV
FIENRYKGIRTPHKMKFGVSGCTRECAEAQGKDLGIIATDAGWNMYVCGNGGMKPRHADL
LASDLDQETLIKYIDRFMMFYIRTSAPLQRTSVWLGNMEGGVDYLRQVIVEDKLGINEQL
EADIAKLVEAYRCEWNETINDEAQLTRFAHFINSDKRDENVVFVSERQQHRPATFAEKHP
ELKGDILHVAVTE
Download sequence
Identical sequences Q7MDV9
196600.VVA0927 gi|37676587|ref|NP_936983.1| WP_011152229.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]