SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676608|ref|NP_937004.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676608|ref|NP_937004.1|
Domain Number 1 Region: 624-799
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 3-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.77e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0029
Further Details:      
 
Domain Number 3 Region: 493-632
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0095
Further Details:      
 
Domain Number 4 Region: 147-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.78e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676608|ref|NP_937004.1|
Sequence length 827
Comment NAD(P)H-nitrite reductase [Vibrio vulnificus YJ016]
Sequence
MESIVIIGNGMVGHQLVEQLVATGSHLEKRIIVIGEERFVAYDRVHLSAMFSGQSHQDLL
LSSEEWYQKHGIELILGVAVVGIDRQSKRVTLEDESQLSYDQLVFATGSYPFVPPMAGSE
RSKVFVYRTLDDLSQIKQACLGAKKGAVIGGGLLGLEAANALRLLGLETHVVEFAPRLMP
VQLDEGAGAVLKSKIEQLGLTVHTSTATEKIIDGETAYHRMVFKDAPSLEVDVIVFSAGI
RPRDQLARDCGLELGERGGIVVNNACQTSDSEIYAIGECALWQGKIFGLVAPGYAMARVV
AQQLRGGSEAEFSGADMSTKLKLLGVDVASIGDAHKATPKATEMVLHDAAAGIYKKLVVD
QSGTTLLGAILIGDNQDYDVLLQSYLNKTPLPQPVVSLLFDTSALKGDVSDNTVICSCHN
VTKGDLISAIQAGAHELGELKAQTKAGSGCGGCSAMVKSVLDQQLSVMGLEVNTQLCEHF
SQTRQALYHICQVEKIRDFDSLLAKHGKGHGCDICKPTAGSIFSSLWNEHIMEPEHSPLQ
DSNDAFMANLQKDGSYSIVPRIPGGEITPEKLIVLGEVARQYDLYTKITGGQRVDLFGAQ
VEQLPEIWQTLIDAGFETGHAYGKSVRTVKSCVGSTWCRYGVDDSVGLAIELENRYKGLR
APHKLKFAVSGCTRECAEAQSKDIGVIATEKGWNLYVCGNGGMRPRHADLLAADLSKAEL
ITLIDRVLMFYVRTADRLQRTSVWLENLDGGLDYLKSVVLDDSLHLCEQLEQQMAHVVDT
YHCEWQQTLTNPEKLMRFRPFINSTQQSTLLGYQRTRGQRIPVKLEE
Download sequence
Identical sequences Q7MDT8
WP_011152247.1.34622 gi|37676608|ref|NP_937004.1| 196600.VVA0948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]