SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676638|ref|NP_937034.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676638|ref|NP_937034.1|
Domain Number 1 Region: 13-195
Classification Level Classification E-value
Superfamily Phage tail proteins 1.59e-41
Family Baseplate protein-like 0.0012
Further Details:      
 
Domain Number 2 Region: 450-601
Classification Level Classification E-value
Superfamily Phage fibre proteins 1.18e-38
Family Tail-associated lysozyme gp5, C-terminal domain 0.025
Further Details:      
 
Domain Number 3 Region: 372-460
Classification Level Classification E-value
Superfamily gp5 N-terminal domain-like 3.14e-33
Family gp4 N-terminal domain-like 0.00091
Further Details:      
 
Domain Number 4 Region: 209-367
Classification Level Classification E-value
Superfamily Phage tail proteins 0.000000000374
Family Baseplate protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676638|ref|NP_937034.1|
Sequence length 611
Comment hypothetical protein VVA0978 [Vibrio vulnificus YJ016]
Sequence
MKKATQDNKFINISTPYGKDAIILNSFEYREEMSELFSLRVYAYFNGQKGELNQIMGQPV
IIKMDNNSQVMLEPRYFHGFVAKATLAGSRVTKFEDGENYKNIELVVVPKLNFADYKINS
RIFQNKDIKEIISLILGEHGVDFSFSLTKSYAKYNYKVQYEESDLQFVKRLLSEEGLSFC
FSHTKSSHVIEIFDDASYYKPGAEFLIDFNSGTAELGHISSWHEAQSMVIMRSHKSGYDM
KKPASHPNNTAKGSESLFTVPSSEHYEYLGEAESGDQYKTRNTHTIESLQQNAYVCSGES
SCRSFTVGRSFKFGKHEDPSRIGKEFVLSSIVINAAVFNQVGHGGPSNQGVRSYFTCIES
GKVHRPAVNFVRPVIRGIQTAVVTGNKQGEIYVDKYGRIKVQFHWDREGKFDTTSSCWIR
VAQQIAGNGWGSSFLPRVGQEVIVEFINGDPDQPVVTGSLYNGTQAPPFSLPEKKTQSGY
RSQSVEKGASNYNELRFEDKPGEEHVYLHAEKNFQMVVEDSADVLVENNKTQKITNNLTE
EVGQNVSGKIGKNYSLDIGEVLSLTAGKSIEIKVGGASIQMSSSGEINIKGNKIAINGAS
IALKAGQISLN
Download sequence
Identical sequences Q7MDQ8
196600.VVA0978 gi|37676638|ref|NP_937034.1| WP_011152273.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]