SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676711|ref|NP_937107.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676711|ref|NP_937107.1|
Domain Number 1 Region: 204-516
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.06e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00001
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.24e-28
Family PDI-like 0.00018
Further Details:      
 
Domain Number 3 Region: 104-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.71e-23
Family PDI-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676711|ref|NP_937107.1|
Sequence length 522
Comment alkyl hydroperoxide reductase [Vibrio vulnificus YJ016]
Sequence
MLDQAIKQQLTQYLTNLKQDVRLVVSLDDSKGSQDILALANEIADLSPLITVVRDDAAST
RKPVMTVTNPEKSTALRFAGLPMGHEFTSLVLALLHSGGHPIKLDAETIEQIAQLDKELD
VEVFISLSCQNCPDVVQAFNMMAAINPKIRATMIDGALFQDEVKQRDILAVPSVFVNGEL
FGQGRMSLTEILNKLDDGAAEKAAASLNEKDPYDVLVVGGGPAGAAAAIYAARKGIRTGI
VAQRLGGQVMDTMAIENFISVKHTEGPKLAANLGEHLKEYGVDIITEQQAEKLMGAQYTE
DGKIHVNLQSGATLKSNSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLINKANSLPNVDIITMAQTTEVVG
DGKRVTGLKYKDRNTDEIKQLDLAGIFVQIGLVPNTEWLKDSDVELSARGEIEIGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
Download sequence
Identical sequences Q7MDI5
gi|37676711|ref|NP_937107.1| WP_011152333.1.34622 196600.VVA1051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]