SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676738|ref|NP_937134.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676738|ref|NP_937134.1|
Domain Number 1 Region: 299-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000036
Further Details:      
 
Domain Number 2 Region: 808-1035
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000163
Further Details:      
 
Domain Number 3 Region: 39-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 8.89e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00012
Further Details:      
 
Domain Number 4 Region: 184-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 4.32e-23
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00015
Further Details:      
 
Domain Number 5 Region: 136-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.5e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0026
Further Details:      
 
Domain Number 6 Region: 565-674
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.78e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00067
Further Details:      
 
Domain Number 7 Region: 725-809
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.79e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676738|ref|NP_937134.1|
Sequence length 1050
Comment acriflavin resistence protein [Vibrio vulnificus YJ016]
Sequence
MLSRFFIQRPKFALVISIILTLAGAIALAVLPVAEYPKISPPSVSVTAYYTGASAEVVEQ
AIADPIETSVNGVENMIYMSSKSANDGSYSLNVTFDVGTDPDMAQVNVQNRVAQIESKLP
QEVRMVGVTVKKRSPDLLMVLNFYSPDGKYDDQFLINYINLNVKDQLARVKGISEVNVIG
GGEYAMRVWLDPEKMANLKLTTSDVYSALSQQNVQVAAGRIGAAPYNNPQEVQFNLVTKG
RLESVSEFENVVLRANPDGSSVYLKDVARVELGKKFYDGNGKFRGRDASIVALSLQSDAN
ALESGQAVMELLERLSGNFPEGMAYETSYDTTVFVAESIKGVVKTLIEAILLVIAVTYLF
LGSARATLIPVVAIPVSLIGTFAVMLATGFTINTVTLFGLILAIGIVVDDAILVIENVDT
TMAKDPSISPRKATLMAMKEVTGPIITSTLVLLAVFLPVAMLPGITGIMYRQFALTICIS
VVISSINALTLAPALCSLVLKQGGENTANWFKTFNRGLERVTERYGQVAGFLVKKSLLLV
AFFMVAVAAVAFFAKTTSTAFVPQEDKGILLVNVQLPDSASLSRTEEVTNHLLNMVEQEP
GVDGVTVANGFSFMTGAAASNGASLFIKLHDWEMRNGLNGNHSANAIAQRINGRAAMELP
QAVVFAMGPPAVPGMGAASGFEFVLEDTLGRSRTDLAMVMGEMIQAANQAPEIAYTFSTF
RANVPHYYVDIDREKAQQLGIPLSSIFQTLQGNLGSMYVNDFTMFGKNFRVTMQADSEHR
SSMDDLSRFHVRTSSGEMVPLSTLLSYEQVFEPDVAWRYNMYRSAIIQGQPAPGYSSGDA
IAAMERIAAELLPQGYTYEWTGMAYQEVLAGNQAIYAFALALIFIYLFMVAQYESWTIPL
AIILVVPVATLGSFLALNLTGTPLNLYAQIGLVLLIALAAKNAILIVEFAKQQREEKEVA
IDEAAVQGGKLRFRAVNMTSWSFILGIFPLIFAAGAGHVSQNSLGISLVGGLLCVLLAGT
FLIPGFYALVQRKREQAHGGSTKLIPLDDE
Download sequence
Identical sequences Q7MDF8
gi|37676738|ref|NP_937134.1| 196600.VVA1078 WP_011152354.1.34622 WP_011152354.1.54486 WP_011152354.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]