SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676741|ref|NP_937137.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676741|ref|NP_937137.1|
Domain Number 1 Region: 9-218,330-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-80
Family Bacterial dinuclear zinc exopeptidases 0.0000000137
Further Details:      
 
Domain Number 2 Region: 217-328
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.06e-38
Family Bacterial exopeptidase dimerisation domain 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676741|ref|NP_937137.1|
Sequence length 417
Comment peptidase T [Vibrio vulnificus YJ016]
Sequence
MAKKKRIAMKHLVQRFIRYVTFDTQSNPKKKCCPSTSGQMKFAEHLKQELLDLGLSQVEL
DEHGYLMAKLPSNVAYPVPAIGFIAHMDTAPDASGKNVKPQIIEDYHGGDIALGIGDEVL
SPVQYPELHALHGHNLITTDGTTLLGADNKAGIAEILSAIEMLIENPSIPHGDICIGFTP
DEEIGRGADLFNVERFGAEWAYTIDGGPQGELEYENFNASSADVIFHGVSVHPGTAKDKM
VNAMTLASQFHCRMPADETPETTEGYQGFYHLKSAEMGVARSELGYILRDFERDGIARRK
AFMQSLADDMNTQLKHGSVEIRFTDSYYNMKEKVEPFPHVIELAKQAMEVCDVEPIIKPI
RGGTDGARLSFMGLPCPNIFTGGYNFHGIHEFASIEQMEKSVQVIVKIAELTAKKYA
Download sequence
Identical sequences gi|37676741|ref|NP_937137.1| 196600.VVA1081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]