SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676842|ref|NP_937238.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676842|ref|NP_937238.1|
Domain Number 1 Region: 229-496
Classification Level Classification E-value
Superfamily Ribokinase-like 2.89e-78
Family YjeF C-terminal domain-like 0.0000796
Further Details:      
 
Domain Number 2 Region: 10-252
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 7.59e-65
Family YjeF N-terminal domain-like 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37676842|ref|NP_937238.1|
Sequence length 498
Comment sugar kinase [Vibrio vulnificus YJ016]
Sequence
MTAMDLRKALYTAKQVREGEVGAAANAGVTLYELMERAGRATFAVILNYYPAVSRLCVVC
GKGNNGGDGYVVARLARQQGLYVVLIQSSDAESLSGDAKQAQQAWRDAGGEISDTASLNA
ALSDCDLVVDALLGTGLAGAVRDEMAKLIDAVNLAGKPIVSVDIPSGLCADTGQALPDAI
HADHTVTFIGTKQGLVTGKARAFCGAIHFADLGIGTEFSKLVPSFKTTIERDEITQWRLT
RARCAHKGDHGRVVLLGGNRGMSGAISLAATACARSGAGLVAALTHPESALPLQIHCPEV
MTLGYNEDKRELEKKLDWADVLVVGPGLGTDEWAKKRWNDIANFQGPMVLDADGLNWLAR
YPNHNDQRIITPHPGEAARLLGCSVNEVEADRFAAVSVLQSQYGGVVVLKGAGTLVYDGT
QTFVCNAGNPGMATGGMGDVLSGVIGALLVQKLPLLRAASLGVLLHSCAADICATEKGEI
GLLASDLLDKIRQLLNAD
Download sequence
Identical sequences Q7MD54
196600.VVA1183 gi|37676842|ref|NP_937238.1| WP_011152443.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]