SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676884|ref|NP_937280.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676884|ref|NP_937280.1|
Domain Number 1 Region: 10-79
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000000000235
Family GIY-YIG endonuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676884|ref|NP_937280.1|
Sequence length 98
Comment endonuclease [Vibrio vulnificus YJ016]
Sequence
MSLPEPCPDWSVYLIRTRLNALYCGISNNVERRFCMHQQGKGAKALKGKGPLELVWSVPV
GSKSRALKLERHIKTLRKQDKERLVKGDLLLQLDKFCD
Download sequence
Identical sequences A0A2J9YEJ7 Q7MD12
196600.VVA1224 gi|37676884|ref|NP_937280.1| WP_011152477.1.21633 WP_011152477.1.22778 WP_011152477.1.25536 WP_011152477.1.34622 WP_011152477.1.54486 WP_011152477.1.58885 WP_011152477.1.66581 WP_011152477.1.67868 WP_011152477.1.81460 WP_011152477.1.93668 WP_011152477.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]