SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676912|ref|NP_937308.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676912|ref|NP_937308.1|
Domain Number 1 Region: 276-447
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 2.62e-47
Family MgtE membrane domain-like 0.0000937
Further Details:      
 
Domain Number 2 Region: 140-272
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000771
Family CBS-domain pair 0.003
Further Details:      
 
Domain Number 3 Region: 34-132
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000000327
Family MgtE N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676912|ref|NP_937308.1|
Sequence length 448
Comment magnesium transporter MgtE [Vibrio vulnificus YJ016]
Sequence
MSEYQDLPLLIEQIAQAEDAEQIVLLNDSIEHGLESGSIALILESQPVDDRVRLWRALPL
EMHIDVLTDMRADARYSVINALSEIELKLTLAKLDNLSLIEWADSLPEEIINEALSLIQK
DELELFDLANKYGDDELGRWAERKIITLPFNISVDRAKRLMEKYSFDTPQQVYLINKKKQ
FRGVVNYYEILRSEGHTVLKNLVIDPVILLSSKMALAEAVEAVEHSSLPALPVVDEDQTL
IGEVDWQFALTTQREIYEARLMAGTGMDEGDDLFAPVIKSSKKRGVWLGINLLTAILASV
TIGLFEDVIAQVVALAVLMPIVASMGGIAGSQTLTLMVRAMALNQITPGNRFALFKNEFG
IGAINGLLWAIIIGGLAALWFQSPLLGGTIALAIIVNIITAAMFGVLIPIILDKLDLDPA
LAGSVILTTVTDVVGFFAFLGTASLVLL
Download sequence
Identical sequences A0A087IMM6 A0A0H0XX04 A0A1L9L0P6 Q7MCY4
196600.VVA1252 216895.VV2_0785 gi|37676912|ref|NP_937308.1| WP_011081708.1.100126 WP_011081708.1.13374 WP_011081708.1.16238 WP_011081708.1.17874 WP_011081708.1.21633 WP_011081708.1.22486 WP_011081708.1.22778 WP_011081708.1.24453 WP_011081708.1.25536 WP_011081708.1.28215 WP_011081708.1.28571 WP_011081708.1.30871 WP_011081708.1.31968 WP_011081708.1.33883 WP_011081708.1.34622 WP_011081708.1.39407 WP_011081708.1.39524 WP_011081708.1.43691 WP_011081708.1.47396 WP_011081708.1.49981 WP_011081708.1.53782 WP_011081708.1.54603 WP_011081708.1.54858 WP_011081708.1.553 WP_011081708.1.59022 WP_011081708.1.59048 WP_011081708.1.59451 WP_011081708.1.60167 WP_011081708.1.61535 WP_011081708.1.63825 WP_011081708.1.66581 WP_011081708.1.67868 WP_011081708.1.73066 WP_011081708.1.73173 WP_011081708.1.78369 WP_011081708.1.79678 WP_011081708.1.81060 WP_011081708.1.81460 WP_011081708.1.81555 WP_011081708.1.82587 WP_011081708.1.8292 WP_011081708.1.8379 WP_011081708.1.84562 WP_011081708.1.86005 WP_011081708.1.86748 WP_011081708.1.93668 WP_011081708.1.94371 WP_011081708.1.95941 WP_011081708.1.96968 gi|27367196|ref|NP_762723.1| gi|320159003|ref|YP_004191381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]