SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676916|ref|NP_937312.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676916|ref|NP_937312.1|
Domain Number 1 Region: 574-766
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-35
Family ATP-dependent protease Lon (La), catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 40-114,341-548
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000256
Family Extended AAA-ATPase domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676916|ref|NP_937312.1|
Sequence length 796
Comment ATP-dependent protease [Vibrio vulnificus YJ016]
Sequence
MTRTINKEAAMAIQRLSAAQLYSVAELEQLPCKSTKELAPIDEIVGQERAQKAVEFAMSI
KEKGYNIYAIGQNGLGKRTMILRYLNRHQHDVNALYDWCYVANFEDIRTPKVLKLPQGVG
VQFRNDIEKLMTKLVNAMPLAFDNEMYYSRADKLKNQLVQKQEQELERITKDAKEKGISL
TITTQGDYQFVALNGEELHTEETFDALSRKEQEYFGASIDELEVNLRSMVRNLTEWEESY
SEKIKKLNDDVTRDVITHFIKQLKLDYSQYPEIKTYLTELQKDIIENADIFLEETSEQGE
VATASLDKKLPRRYKVNVLVSRKTGEFPIVVEETPNYHTLFGSIETATFKGTVFTDFSLI
RAGSLHKANGGVLLMDAQKVLEQPYVWDGLKRALRSRQLSFTSLEKEVTLTGAVSLDPEP
IPLDIKIILFGDYRTYQLLQHYDPEFSELFRVTADFEDEMKRTPESELQYARFISSVVHD
NGMLHCDKKAIARIIEHSSRLVGDQGKLSLHSAHIANLLRESNYVAKQSNSNMIRIGHVE
EALSNQEMRVSRLQDAVMEGFINGTTLIRTEGSAVGQVNALSVLSTSDHAFGAPNRITAT
TCYGDGEVIDIERSVDLGGSIHSKGVMILSAYLSSVFGRNAKVPLTTTITFEQSYGGVDG
DSASMAELCAVVSAFSKQPNRQDIAITGSMNQFGESQPIGGVNEKIEGFFDVCAIKGRHD
QQGVIIPRSNVHNLMLRPDIVKAVEKGDFHIWAIDHVTEAIEIFTGKSAGEPTDDGSYPI
DTIFGIAQAKLNALRK
Download sequence
Identical sequences Q7MCY0
gi|37676916|ref|NP_937312.1| 196600.VVA1256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]