SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37676991|ref|NP_937387.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676991|ref|NP_937387.1|
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 8.24e-42
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37676991|ref|NP_937387.1|
Sequence length 147
Comment phosphotransferase system mannitol/fructose-specific IIA component [Vibrio vulnificus YJ016]
Sequence
MLSELITSDVIRVHPQATDWQDAVQKSCQALIDNGAVEARYVDAIFRSHQELGPYYVIGP
GMAMPHARPEDGVNRLALAITVIQQGVHFDSEGNDPVKMLVTLAATDSNSHVGAIAKLAE
LFMNEEHVEQICQAQTPDDVLAVIKNY
Download sequence
Identical sequences A0A087IAF7 A0A0H0XXB7 Q7MCQ5
gi|320159075|ref|YP_004191453.1| 196600.VVA1331 216895.VV2_0860 gi|27367266|ref|NP_762793.1| WP_011081777.1.13374 WP_011081777.1.16238 WP_011081777.1.17874 WP_011081777.1.21633 WP_011081777.1.22486 WP_011081777.1.22778 WP_011081777.1.24453 WP_011081777.1.25536 WP_011081777.1.28215 WP_011081777.1.28571 WP_011081777.1.30871 WP_011081777.1.31968 WP_011081777.1.34622 WP_011081777.1.39407 WP_011081777.1.47396 WP_011081777.1.512 WP_011081777.1.53782 WP_011081777.1.54486 WP_011081777.1.54603 WP_011081777.1.55006 WP_011081777.1.553 WP_011081777.1.58875 WP_011081777.1.58885 WP_011081777.1.59048 WP_011081777.1.59451 WP_011081777.1.60167 WP_011081777.1.60868 WP_011081777.1.61535 WP_011081777.1.63462 WP_011081777.1.63825 WP_011081777.1.65015 WP_011081777.1.66219 WP_011081777.1.66581 WP_011081777.1.67868 WP_011081777.1.73066 WP_011081777.1.73173 WP_011081777.1.79678 WP_011081777.1.81460 WP_011081777.1.81555 WP_011081777.1.8379 WP_011081777.1.84562 WP_011081777.1.86748 WP_011081777.1.90288 WP_011081777.1.95941 WP_011081777.1.96968 WP_011081777.1.9921 WP_011081777.1.99976 gi|37676991|ref|NP_937387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]