SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677032|ref|NP_937428.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677032|ref|NP_937428.1|
Domain Number 1 Region: 2-186,298-373
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.37e-39
Family Bacterial dinuclear zinc exopeptidases 0.00062
Further Details:      
 
Domain Number 2 Region: 177-285
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.44e-23
Family Bacterial exopeptidase dimerisation domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37677032|ref|NP_937428.1|
Sequence length 374
Comment carboxypeptidase G2 [Vibrio vulnificus YJ016]
Sequence
MQFSLEHYLEELKPLINVDCGTYTLEGIEYIASQFEQKFQAMNGWQVKRVDCGKAGVGLE
IRNQPDAAHIDVMMIGHMDTVFPVGTAAVRPMSLDAEKAYGPGVSDMKSGLLNIVYAMRN
LDQAVLDKLSICICMNPDEETGSGDSVEWIQSVAKLAKNVLVAEAARADGGLVKARKGMA
GYKINFKGIAAHAGNDPEKGRSAITEMAQWIMAINAMTNFESGTTLNVGVVSGGAGANIV
PEHAQAVVDVRFWNNAEYDDVDTKLNAMAQTPFVDGVSVTIEREAYKPSMVPSEQTEGLM
KLVESAAQELSIDLNWHAVGGGSDANNTAILGVPTLDGLGPIGAGFHSDQEYLVLASIEP
RIRMLMRVLEKLAA
Download sequence
Identical sequences Q7MCL4
WP_011152602.1.34622 gi|37677032|ref|NP_937428.1| 196600.VVA1372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]