SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677052|ref|NP_937448.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677052|ref|NP_937448.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.96e-35
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37677052|ref|NP_937448.1|
Sequence length 199
Comment PTS fructose-specific enzyme IIA component-like protein [Vibrio vulnificus YJ016]
Sequence
MKLAQLTTPELIMLDAVFEDRFSAINALTDKLEQTGKLTNKAQFLEAVLKREEEGPTALG
EYLAVPHGKSEAVKEPVFACAFVKDELMWKGLDGDEPVNMIFLLAIPPAEAGSTHMEVLT
TLTSSLVDDDFRDQLLAARTTQEIMALFGEDGADSEPQVEQSEAESAQQDNVAKDISSIA
YPVVLGIGVIISAFLFLLL
Download sequence
Identical sequences Q7MCJ4
gi|37677052|ref|NP_937448.1| 196600.VVA1392 WP_011152619.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]