SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677055|ref|NP_937451.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677055|ref|NP_937451.1|
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.92e-32
Family PTS system, Fructose specific IIB subunit-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37677055|ref|NP_937451.1|
Sequence length 468
Comment phosphotransferase system, fructose-specific IIC component [Vibrio vulnificus YJ016]
Sequence
MSKKKLVAVTACPTGIAHTFMAAKKIKSWADKHGYEVKVETQGSDGVKNRLTAHDIATAD
GVVLAVDVPIMDMERFDNANPLKVRTQELIKHVDALLPTVFQRGKEKSAALSELPIEEKR
SAYQVAIGHIMTGISYMLPVVVLGGLLMAVAKITGEFIDISGTPIQTLDKLGFMTIKFMY
PIFAAYLAYSIAGKPALIPAFIGGVMSDEVYKRFFDLEGWAPSGFFGAIAIGFLVGYLVR
FLNDTIKVKSELTTLKTMLVVPAITGVVMVLTMEYIINPFFGALNIAMINLFTEAGDAGR
GIYSMVIAAGTAFDLGGPINKAAGSVALGLNGMGEGFDLIARELGIVIPPIGVGLAALLD
GKFRPRVFSPEEQTVGKTSLMLGLIGISEGAIPFILKNPKMIPIMILGSIIGTQLAVVLN
VFQSLPLPAVWGWFLSSDPVSYTISVIAGSLFIAVALLLCTKPQPTQA
Download sequence
Identical sequences A0A0A3EZP3 Q7MCJ1
WP_005429127.1.12359 WP_005429127.1.19947 WP_005429127.1.32528 WP_005429127.1.34412 WP_005429127.1.34622 WP_005429127.1.53497 WP_005429127.1.57729 WP_005429127.1.5980 WP_005429127.1.74002 WP_005429127.1.78839 WP_005429127.1.79102 WP_005429127.1.83275 WP_005429127.1.90381 WP_005429127.1.94413 gi|37677055|ref|NP_937451.1| 196600.VVA1395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]