SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677064|ref|NP_937460.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677064|ref|NP_937460.1|
Domain Number 1 Region: 154-274
Classification Level Classification E-value
Superfamily CBS-domain pair 6.06e-24
Family CBS-domain pair 0.0006
Further Details:      
 
Domain Number 2 Region: 11-143
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000196
Family cAMP-binding domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|37677064|ref|NP_937460.1|
Domain Number - Region: 326-388
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0048
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.038
Further Details:      
 
Domain Number - Region: 525-576
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0361
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37677064|ref|NP_937460.1|
Sequence length 621
Comment signal-transduction protein [Vibrio vulnificus YJ016]
Sequence
MGTSVTPNIVDFLVRIDPFDKLPKALVESLANSVQIKYLVKGETISFSSLCETRYLYIIR
TGAIEQRTPTGDLRARLGHEDQFGFTFLAPLDNAENGYQAEAIEDALLYLIPHHELKKVC
DSHPEFADYFAAQANLRLSSAVNFVCQKEEKGLFFRTVGEIASENIAIVKVTDSIRDVAI
TMCGKQRSSCAVVMDGNDIVGLVTDRDMTASVVAKEKDVSERIESVMKLNPVLIESDAKV
IQAISLMLQYNIRCLPVVNHGKVAGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALK
EERQTIFQALVESGVSAEIQGKVMSMIMDAFTRRIIQLNEEVLGAPPCDYAWMVAGSHAR
NEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQP
VSRWKEYYQKWVASPEYNKLLSISVFLEVRSIHGSRELVEQIQQHLHHCIQQSPSFIPAL
VRDAIDTQPPLGIFNHLVLEKGGQNSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEER
FRFAVEHGTLSKGSCDNIIGAYRFITQVRFRHQLNAILAGKTPDNHISPDEISSFERKHL
KDAFKIISELQDVAKLKFVKG
Download sequence
Identical sequences Q7MCI2
gi|37677064|ref|NP_937460.1| 196600.VVA1404 WP_011152628.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]