SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677076|ref|NP_937472.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677076|ref|NP_937472.1|
Domain Number 1 Region: 791-1019
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.0005
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.81e-36
Family Multidrug efflux transporter AcrB transmembrane domain 0.00065
Further Details:      
 
Domain Number 3 Region: 46-137
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.14e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0042
Further Details:      
 
Domain Number 4 Region: 185-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000615
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.002
Further Details:      
 
Domain Number 5 Region: 146-183,269-325
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000136
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0069
Further Details:      
 
Domain Number 6 Region: 719-793
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000275
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.012
Further Details:      
 
Weak hits

Sequence:  gi|37677076|ref|NP_937472.1|
Domain Number - Region: 564-651
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0157
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37677076|ref|NP_937472.1|
Sequence length 1045
Comment multidrug resistance protein [Vibrio vulnificus YJ016]
Sequence
MESNQQRGLISYFAHNSVAANLLMVFIIIMGIVSFFFIQRQMFPNIEVNYINVSASYPGA
SPQEIEESILLKMEESLKDVTGIKQAVSTASRGNAHISLEINVKADIKEVLDDVKQRIST
IASFPKGMEPVNIYQYEFRQDVIELSLVGDRPLEELKPIAKKIEDELLQLQNVMLVELSA
PEEEIAIEVDPLVLRKYDLTLNDVTNAIRRYSANYSAGEVSTSAGMIAVRIENQYYKGEE
FRNIPVKLGANGAKVLLQDIATIKDGFTEAERYFQFSGQNAIYLSVKATKDQDMIPVAES
VKAYIAHKNELLPDDLQIKTLVDMTYYLQGRLDMMLKNLLQGAVLVAIMLSIFLRVRLAL
WVMIGLPVCFLGAVMVMPFIGVTINIVSLFAFIMVLGIVVDDAIVIGESAYSEIEKKGGG
VDNVITGVKKVATPATFGVLTTIAVFAPFLMSSGPERAFFVGIAAVVMLCLIFSLIESKL
ILPAHLAHTKFSPIKPDGWRARFNTRFFGFVNGPYQRFVRKCTHWRWSVMAFFVVLLVIS
VGLVTSNHVRIIMNPKVPTDFPAVTVKMNDNVSSEQTIDALKQIEQVINEVEEETIAQHG
RGMIRDMLSYNRGRTEGRIVVPLVDEELRPFNTFELSRMWREKLPTLAGVKSLTIRDATN
SGDDGDEFGYRLFGTDIEQLNAAGRYLITRLQEQNGLFDISSSIDSGSKEVLLSLAPVAY
DLGLDLTMIAEQVGGSFYGGEAQRFIRDGEELKVMVRYPKLTREAFASLRYAVITTPTGK
KVMLGDVVTIDEQPGVSSIRREQGYKTVYVYGSIDEEVVEPNEVVKTVRESLLPELKEKF
PGVRTELGGSIEEQQAQRNEQIIFFVAGMIIVYILLAVPLKSYTQPLIVMSVIPFSLTGA
IWGHYWLGLDISMMSTFGLIAAAGVVINDSLVMTDYVNQVRREGMSIKDAVVQAGCARFR
AITLTSITTFVGVLPIMFETSLQARFVIPMAVALGFAVLFATLLTLVLVPCLYLILEDIK
HLLGKVWRGLCYPWRRFSSLRKANA
Download sequence
Identical sequences Q7MCH1
WP_011152638.1.34622 196600.VVA1416 gi|37677076|ref|NP_937472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]