SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37677083|ref|NP_937479.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677083|ref|NP_937479.1|
Domain Number 1 Region: 216-264
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000538
Family AraC type transcriptional activator 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37677083|ref|NP_937479.1|
Sequence length 268
Comment AraC family transcriptional regulator [Vibrio vulnificus YJ016]
Sequence
MGVTMKSLIQLAYYRGVNTQALRNVAILTPSIIQITTGSKRLYWQETTLDIDAHSLLLCR
ANHALHFENLPQAGQFSSRQFCFSLPPTSEMLSLSERNGTTTPHLTLHHPVVRCDKALNH
TLNLLAGLPLDELSTETLTFWLYGFYQQLAERGVLHLMFTPQGQSFEQKLSEFIAQQPSK
DHQIEDACQHFAISKATLIRRLKEEGTQYREVLSKVRLSHALNLMQQGHRKTAELSLMCG
YQSPDKFSQRFRQRFGLSPREYCKTLPN
Download sequence
Identical sequences Q7MCG4
WP_011152645.1.34622 196600.VVA1423 gi|37677083|ref|NP_937479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]