SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677092|ref|NP_937488.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677092|ref|NP_937488.1|
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.92e-57
Family G proteins 0.0000852
Further Details:      
 
Domain Number 2 Region: 457-577
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-39
Family Translational machinery components 0.0000275
Further Details:      
 
Domain Number 3 Region: 243-371
Classification Level Classification E-value
Superfamily Translation proteins 7.07e-22
Family Elongation factors 0.0021
Further Details:      
 
Domain Number 4 Region: 581-669
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.01e-20
Family EF-G/eEF-2 domains III and V 0.00056
Further Details:      
 
Domain Number 5 Region: 380-457
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.68e-18
Family EF-G/eEF-2 domains III and V 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37677092|ref|NP_937488.1|
Sequence length 672
Comment elongation factor G [Vibrio vulnificus YJ016]
Sequence
MPINKIRNIAFVGQSGSGKTTLIEKLLFACDATTHLGSIEKGDTVTDFDDQSIQYQHSIE
ATPVALSWQKHRLNIIDTPGLSELLGRSLSVFPAVETSVLVLDPQMPLTQVTDKLFQFAQ
QQKKCQMIIINKLDNHGNQLEKLLDEIQDHFGSNCLPINLPSADGNEVVDCFFEPQYQQA
TLLSSVEATHETLIDQVVEVDEELMELYLEQGSELTPAQLHDPFEEALRTGHVVPICFAS
AQTGAGIELLLRTLAELMPMPNEGNPPLLQKNGKMIKVNCDTLEHTVAHVYKISVDPYMG
KLAYLRVFQGEINAGSQLYVGESNKAFKVGHLYQLQGKQRTEISRALAGDFCVLAKVDEL
EFDSIVHDSHDEDDVSLKTLHFPQPMYSLSLKPTKRGDEQKLGEVLNRIVSEDPSLRLEH
RARTNETILSGQGEFHLKIALEKMASVYKLEVDTEQPSVEYFETITKPAEGQYRHKKQSG
GAGQFGEVHLSVKPLERGAGFKFVNKVVGGAIPTSLIPAVEKGIHQALEEGAISNNPIRD
IEVTVHDGKYHSVDSKEIAFVIAGKKAFLDAVKKADPIVLEPIVQLELTIPTSNVGDVTG
DLSGNRGLIEGTEPQANNLTLIKGKSPLNELQDYARKLRALTGGEGSFNMSLSHYEPAPP
AVQKRVCEETTS
Download sequence
Identical sequences Q7MCF5
gi|37677092|ref|NP_937488.1| WP_011152654.1.34622 196600.VVA1432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]