SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677171|ref|NP_937567.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677171|ref|NP_937567.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily PTS system fructose IIA component-like 4.84e-34
Family EIIA-man component-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37677171|ref|NP_937567.1|
Sequence length 151
Comment phosphotransferase system, mannose/fructose-specific component IIA [Vibrio vulnificus YJ016]
Sequence
MIAVILSGHGGFASGIAQAIAQVIGEQEQFRFLDFPEQMTTPQLEVAMRQAIEEIDSGDG
IVFLTDLLGGTPFRTASLLSQERDDIEVVTGTNMQMAAEMLLERDELTLTAFREMAVECG
HRGITSLAAEMALKAQQAATQPSAVVEEDGI
Download sequence
Identical sequences A0A087I9Y9 Q7MC76
gi|27367410|ref|NP_762937.1| 196600.VVA1511 216895.VV2_1019 gi|37677171|ref|NP_937567.1| gi|320159259|ref|YP_004191637.1| WP_011081923.1.13374 WP_011081923.1.17874 WP_011081923.1.22486 WP_011081923.1.24453 WP_011081923.1.25536 WP_011081923.1.28215 WP_011081923.1.28571 WP_011081923.1.30871 WP_011081923.1.31968 WP_011081923.1.34622 WP_011081923.1.39407 WP_011081923.1.39524 WP_011081923.1.43691 WP_011081923.1.47396 WP_011081923.1.49981 WP_011081923.1.53782 WP_011081923.1.54603 WP_011081923.1.553 WP_011081923.1.59048 WP_011081923.1.59451 WP_011081923.1.60167 WP_011081923.1.60868 WP_011081923.1.61535 WP_011081923.1.63462 WP_011081923.1.65015 WP_011081923.1.66219 WP_011081923.1.73066 WP_011081923.1.73173 WP_011081923.1.81060 WP_011081923.1.82587 WP_011081923.1.8379 WP_011081923.1.84562 WP_011081923.1.86005 WP_011081923.1.86748 WP_011081923.1.90288 WP_011081923.1.95941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]