SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677251|ref|NP_937647.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37677251|ref|NP_937647.1|
Domain Number - Region: 52-124
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 0.1
Family ProC C-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37677251|ref|NP_937647.1|
Sequence length 173
Comment C4-dicarboxylate ABC transporter permease [Vibrio vulnificus YJ016]
Sequence
MKMNKLVTYINRGLAAFTVSLSTFLVFCVVWQVLSRYVLGKPSTVTDELARYLFMWVALI
GAAYTTGLKRHLAIDLLTMKLKGKKKLVNEIVIQVAIALFSYVVLVHGGTQLALKTLATG
QLTPALGLEMGYIYFCLPISGALMIFYSVIFAYERVKQLMSGETLVTDSQLDS
Download sequence
Identical sequences A0A087I9U1 A0A0H0XXU2 A0A0L8CNS1 Q7MBZ6 Q87FH6
NP_801213.1.6614 WP_011081969.1.100126 WP_011081969.1.100143 WP_011081969.1.100407 WP_011081969.1.100494 WP_011081969.1.100744 WP_011081969.1.100951 WP_011081969.1.101108 WP_011081969.1.101317 WP_011081969.1.10139 WP_011081969.1.10142 WP_011081969.1.101585 WP_011081969.1.101665 WP_011081969.1.101930 WP_011081969.1.102109 WP_011081969.1.10270 WP_011081969.1.10528 WP_011081969.1.10558 WP_011081969.1.108 WP_011081969.1.10872 WP_011081969.1.10999 WP_011081969.1.11159 WP_011081969.1.11219 WP_011081969.1.12087 WP_011081969.1.12658 WP_011081969.1.12933 WP_011081969.1.130 WP_011081969.1.13068 WP_011081969.1.13374 WP_011081969.1.13595 WP_011081969.1.14243 WP_011081969.1.14943 WP_011081969.1.15211 WP_011081969.1.1555 WP_011081969.1.15563 WP_011081969.1.15887 WP_011081969.1.16073 WP_011081969.1.16091 WP_011081969.1.16138 WP_011081969.1.16176 WP_011081969.1.16238 WP_011081969.1.16503 WP_011081969.1.16663 WP_011081969.1.16742 WP_011081969.1.17331 WP_011081969.1.17580 WP_011081969.1.17874 WP_011081969.1.17941 WP_011081969.1.1836 WP_011081969.1.19074 WP_011081969.1.19108 WP_011081969.1.19647 WP_011081969.1.19755 WP_011081969.1.20389 WP_011081969.1.20403 WP_011081969.1.20587 WP_011081969.1.21130 WP_011081969.1.21357 WP_011081969.1.21633 WP_011081969.1.22008 WP_011081969.1.22207 WP_011081969.1.22486 WP_011081969.1.22509 WP_011081969.1.22778 WP_011081969.1.22854 WP_011081969.1.22903 WP_011081969.1.22951 WP_011081969.1.234 WP_011081969.1.23893 WP_011081969.1.24049 WP_011081969.1.24359 WP_011081969.1.24453 WP_011081969.1.24486 WP_011081969.1.24866 WP_011081969.1.25315 WP_011081969.1.25390 WP_011081969.1.25430 WP_011081969.1.25536 WP_011081969.1.26080 WP_011081969.1.26160 WP_011081969.1.26203 WP_011081969.1.26245 WP_011081969.1.264 WP_011081969.1.266 WP_011081969.1.26685 WP_011081969.1.26700 WP_011081969.1.26729 WP_011081969.1.26870 WP_011081969.1.27000 WP_011081969.1.27033 WP_011081969.1.27116 WP_011081969.1.27450 WP_011081969.1.27735 WP_011081969.1.28571 WP_011081969.1.28753 WP_011081969.1.28858 WP_011081969.1.29695 WP_011081969.1.29784 WP_011081969.1.29832 WP_011081969.1.29877 WP_011081969.1.29928 WP_011081969.1.29975 WP_011081969.1.30244 WP_011081969.1.30327 WP_011081969.1.30871 WP_011081969.1.31628 WP_011081969.1.31646 WP_011081969.1.31765 WP_011081969.1.31968 WP_011081969.1.31998 WP_011081969.1.32328 WP_011081969.1.32508 WP_011081969.1.32844 WP_011081969.1.33572 WP_011081969.1.33694 WP_011081969.1.3371 WP_011081969.1.33883 WP_011081969.1.3431 WP_011081969.1.34442 WP_011081969.1.34622 WP_011081969.1.35169 WP_011081969.1.35267 WP_011081969.1.35351 WP_011081969.1.35556 WP_011081969.1.35596 WP_011081969.1.35739 WP_011081969.1.35751 WP_011081969.1.36197 WP_011081969.1.36274 WP_011081969.1.36530 WP_011081969.1.36619 WP_011081969.1.36760 WP_011081969.1.36788 WP_011081969.1.3684 WP_011081969.1.3696 WP_011081969.1.36970 WP_011081969.1.36990 WP_011081969.1.36991 WP_011081969.1.37000 WP_011081969.1.37148 WP_011081969.1.37633 WP_011081969.1.37683 WP_011081969.1.38010 WP_011081969.1.38461 WP_011081969.1.38633 WP_011081969.1.39 WP_011081969.1.39142 WP_011081969.1.39181 WP_011081969.1.39379 WP_011081969.1.39524 WP_011081969.1.3961 WP_011081969.1.39756 WP_011081969.1.39826 WP_011081969.1.39842 WP_011081969.1.40049 WP_011081969.1.40051 WP_011081969.1.40386 WP_011081969.1.40625 WP_011081969.1.41234 WP_011081969.1.41418 WP_011081969.1.4157 WP_011081969.1.42059 WP_011081969.1.42776 WP_011081969.1.42858 WP_011081969.1.42884 WP_011081969.1.43185 WP_011081969.1.43691 WP_011081969.1.43825 WP_011081969.1.43895 WP_011081969.1.44068 WP_011081969.1.45009 WP_011081969.1.45334 WP_011081969.1.45564 WP_011081969.1.45633 WP_011081969.1.45795 WP_011081969.1.46057 WP_011081969.1.46489 WP_011081969.1.46672 WP_011081969.1.47046 WP_011081969.1.4734 WP_011081969.1.47396 WP_011081969.1.47510 WP_011081969.1.48035 WP_011081969.1.48559 WP_011081969.1.4861 WP_011081969.1.48612 WP_011081969.1.4902 WP_011081969.1.49031 WP_011081969.1.4923 WP_011081969.1.49388 WP_011081969.1.49432 WP_011081969.1.49445 WP_011081969.1.49766 WP_011081969.1.49920 WP_011081969.1.49981 WP_011081969.1.50114 WP_011081969.1.50290 WP_011081969.1.5033 WP_011081969.1.50640 WP_011081969.1.50833 WP_011081969.1.512 WP_011081969.1.51498 WP_011081969.1.51723 WP_011081969.1.51859 WP_011081969.1.51945 WP_011081969.1.51992 WP_011081969.1.52405 WP_011081969.1.52454 WP_011081969.1.5250 WP_011081969.1.52959 WP_011081969.1.53043 WP_011081969.1.53064 WP_011081969.1.53114 WP_011081969.1.53207 WP_011081969.1.53370 WP_011081969.1.53435 WP_011081969.1.53634 WP_011081969.1.53782 WP_011081969.1.53943 WP_011081969.1.54059 WP_011081969.1.54070 WP_011081969.1.5410 WP_011081969.1.54486 WP_011081969.1.54603 WP_011081969.1.54608 WP_011081969.1.5471 WP_011081969.1.54719 WP_011081969.1.54858 WP_011081969.1.55006 WP_011081969.1.55108 WP_011081969.1.55195 WP_011081969.1.55280 WP_011081969.1.553 WP_011081969.1.55354 WP_011081969.1.5595 WP_011081969.1.56068 WP_011081969.1.56123 WP_011081969.1.56134 WP_011081969.1.56138 WP_011081969.1.5619 WP_011081969.1.56232 WP_011081969.1.56836 WP_011081969.1.56842 WP_011081969.1.56899 WP_011081969.1.5699 WP_011081969.1.57128 WP_011081969.1.57129 WP_011081969.1.57237 WP_011081969.1.57332 WP_011081969.1.57390 WP_011081969.1.5768 WP_011081969.1.57773 WP_011081969.1.57934 WP_011081969.1.58273 WP_011081969.1.58356 WP_011081969.1.58748 WP_011081969.1.58791 WP_011081969.1.58875 WP_011081969.1.58885 WP_011081969.1.59022 WP_011081969.1.59048 WP_011081969.1.59403 WP_011081969.1.59451 WP_011081969.1.5962 WP_011081969.1.59786 WP_011081969.1.59887 WP_011081969.1.59976 WP_011081969.1.60089 WP_011081969.1.60100 WP_011081969.1.60167 WP_011081969.1.60172 WP_011081969.1.60533 WP_011081969.1.606 WP_011081969.1.60868 WP_011081969.1.61129 WP_011081969.1.61535 WP_011081969.1.61745 WP_011081969.1.61913 WP_011081969.1.62401 WP_011081969.1.62711 WP_011081969.1.6274 WP_011081969.1.62759 WP_011081969.1.63024 WP_011081969.1.63301 WP_011081969.1.63316 WP_011081969.1.63462 WP_011081969.1.63825 WP_011081969.1.6404 WP_011081969.1.64057 WP_011081969.1.64243 WP_011081969.1.64933 WP_011081969.1.65015 WP_011081969.1.65279 WP_011081969.1.65760 WP_011081969.1.66030 WP_011081969.1.66211 WP_011081969.1.66219 WP_011081969.1.66240 WP_011081969.1.66438 WP_011081969.1.66581 WP_011081969.1.66625 WP_011081969.1.66850 WP_011081969.1.67224 WP_011081969.1.67475 WP_011081969.1.67868 WP_011081969.1.67872 WP_011081969.1.68016 WP_011081969.1.68633 WP_011081969.1.68676 WP_011081969.1.68976 WP_011081969.1.69138 WP_011081969.1.69352 WP_011081969.1.69774 WP_011081969.1.70106 WP_011081969.1.70743 WP_011081969.1.70795 WP_011081969.1.70848 WP_011081969.1.7091 WP_011081969.1.71164 WP_011081969.1.71210 WP_011081969.1.71278 WP_011081969.1.71559 WP_011081969.1.71997 WP_011081969.1.72377 WP_011081969.1.72386 WP_011081969.1.72419 WP_011081969.1.72707 WP_011081969.1.72794 WP_011081969.1.73066 WP_011081969.1.73171 WP_011081969.1.73173 WP_011081969.1.7318 WP_011081969.1.7370 WP_011081969.1.73712 WP_011081969.1.74603 WP_011081969.1.74813 WP_011081969.1.74936 WP_011081969.1.75184 WP_011081969.1.75223 WP_011081969.1.75461 WP_011081969.1.75707 WP_011081969.1.76255 WP_011081969.1.77322 WP_011081969.1.77748 WP_011081969.1.77954 WP_011081969.1.78369 WP_011081969.1.78441 WP_011081969.1.78668 WP_011081969.1.78886 WP_011081969.1.78902 WP_011081969.1.78935 WP_011081969.1.79225 WP_011081969.1.79678 WP_011081969.1.79694 WP_011081969.1.79702 WP_011081969.1.79711 WP_011081969.1.7973 WP_011081969.1.80498 WP_011081969.1.8080 WP_011081969.1.80922 WP_011081969.1.81014 WP_011081969.1.81130 WP_011081969.1.81246 WP_011081969.1.81460 WP_011081969.1.81555 WP_011081969.1.81752 WP_011081969.1.81782 WP_011081969.1.81805 WP_011081969.1.81887 WP_011081969.1.81992 WP_011081969.1.82047 WP_011081969.1.82387 WP_011081969.1.82587 WP_011081969.1.8274 WP_011081969.1.82791 WP_011081969.1.82806 WP_011081969.1.8292 WP_011081969.1.83069 WP_011081969.1.83207 WP_011081969.1.83328 WP_011081969.1.83411 WP_011081969.1.8373 WP_011081969.1.8379 WP_011081969.1.84036 WP_011081969.1.84073 WP_011081969.1.84311 WP_011081969.1.84324 WP_011081969.1.84562 WP_011081969.1.84568 WP_011081969.1.84802 WP_011081969.1.85177 WP_011081969.1.85334 WP_011081969.1.85843 WP_011081969.1.86005 WP_011081969.1.86416 WP_011081969.1.86431 WP_011081969.1.8650 WP_011081969.1.86700 WP_011081969.1.86748 WP_011081969.1.87206 WP_011081969.1.87211 WP_011081969.1.87761 WP_011081969.1.88312 WP_011081969.1.88333 WP_011081969.1.88760 WP_011081969.1.88852 WP_011081969.1.89122 WP_011081969.1.89256 WP_011081969.1.89397 WP_011081969.1.89904 WP_011081969.1.89979 WP_011081969.1.90016 WP_011081969.1.90288 WP_011081969.1.90588 WP_011081969.1.90891 WP_011081969.1.91304 WP_011081969.1.91820 WP_011081969.1.91910 WP_011081969.1.92596 WP_011081969.1.92710 WP_011081969.1.92787 WP_011081969.1.92816 WP_011081969.1.92867 WP_011081969.1.93145 WP_011081969.1.93458 WP_011081969.1.93476 WP_011081969.1.93668 WP_011081969.1.93749 WP_011081969.1.94455 WP_011081969.1.94697 WP_011081969.1.94882 WP_011081969.1.95057 WP_011081969.1.95147 WP_011081969.1.95941 WP_011081969.1.96237 WP_011081969.1.96264 WP_011081969.1.9642 WP_011081969.1.96491 WP_011081969.1.96879 WP_011081969.1.96968 WP_011081969.1.97304 WP_011081969.1.97440 WP_011081969.1.97659 WP_011081969.1.9827 WP_011081969.1.9921 WP_011081969.1.99239 WP_011081969.1.994 WP_011081969.1.99780 WP_011081969.1.99805 WP_011081969.1.99976 gi|326424337|ref|NP_762984.2| gi|37677251|ref|NP_937647.1| 196600.VVA1591 223926.VPA1703 gi|28901558|ref|NP_801213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]