SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677257|ref|NP_937653.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37677257|ref|NP_937653.1|
Domain Number - Region: 18-143
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0602
Family Clc chloride channel 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37677257|ref|NP_937653.1|
Sequence length 173
Comment hypothetical protein VVA1597 [Vibrio vulnificus YJ016]
Sequence
MENGLAQGIGGIAFLVGVMAFWQKDDLRFRYQMMAFCFIMGVHFALLGATVAAIGVVING
IRSFASIKTQSRKVMWFFIALMWLMTLPNMSHFFEFITVFGSSVATWALFSKQGIALRNL
ILFNSFCWVSHNIWLGSIGGSLVESTFIITNLFTIYRLFQQRNAQRHEAGNRA
Download sequence
Identical sequences Q7MBZ0
196600.VVA1597 WP_011152796.1.34622 gi|37677257|ref|NP_937653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]