SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37677264|ref|NP_937660.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37677264|ref|NP_937660.1|
Domain Number 1 Region: 490-580
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000000000288
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37677264|ref|NP_937660.1|
Sequence length 586
Comment PTS system ascorbate-specific transporter subunits IICB [Vibrio vulnificus YJ016]
Sequence
MEFLYDIFYIFYSQVMTKAPLLLGLVTLIGYWLLRRDTTTIIKGSIKTIVGFMLVQVGAG
TLVAGFKPVISKLSEFHGLTGSVIDPYTSMMSTMETMGDNYSWVGYTVLLALGINILLVL
FRRYTGIRTIMLTGHIMFQQAGLIAVFYFVLGTSMWETIIYSAVLMALYWGISSNIMFKP
TEEVTGGAGFSIGHQQQVASWIATKVAPKLGDKNDSVDHLELPKWLHIFHDSIAATAIVM
TVFFGIILLSFGLDNLQAMAGGTHWSIYILETGLKFAVAIQVIVAGVRMFVAELSEAFKG
ISERVIPNAVLAIDCAAIYAFSPNAMVFGFMWGAVGQFTAVLAMLAFDAPIMIIPGFIPM
FFSNATIGVFANHFGGWKAVMKICFVMGIIEVVGSAWAIHLFNQQGTEFNGWMGMADWAL
VFPPIMQGLSASKMFFFVLVGLSLVYMFFASRKLRAEEDAQGTVVVSEEPDVIEAVEQAI
KASDGVRPVSILAVCGNGQGSSMMMKMKIGKYLEKKGIPHVMDSCAVSDYKSKLASTDII
VSSKHLSAEMEPGEGKFVLGVQNMLNPNSFGDELLDIINKNFVSAK
Download sequence
Identical sequences A0A1W6MCM9 Q7MBY3
WP_011152803.1.21633 WP_011152803.1.22778 WP_011152803.1.34622 WP_011152803.1.93668 196600.VVA1604 gi|37677264|ref|NP_937660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]